KEGG   Methanosarcina sp. MTP4: MSMTP_1128Help
Entry
MSMTP_1128        CDS       T03850                                 

Definition
(GenBank) ATP-dependent DNA ligase clustered with Ku protein, LigD
Organism
metm  Methanosarcina sp. MTP4
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N
Motif
Other DBs
NCBI-ProteinID: AKB24597
UniProt: A0A0E3NXW0
LinkDB All DBs
Position
1440822..1441280
Genome map
AA seq 152 aa AA seqDB search
MLEKYRKKRDFKETPEPAPGNSKKDLDKPIFVIQKHDASTLHYDFRLEIDGVLKSWAVPK
EPPSKAGIKRLAIQTEDHPLEYADFEGEIPEGHYGAGKVEIWDKGTFKLKKFEEKEIIFT
LDGEKLQGGYVMIKTKFGKEGKGWLLFKKKAE
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atgctcgaaaaatacaggaagaaaagggatttcaaagagactcctgaacctgcgccggga
aattcaaaaaaagatctggataaacctatcttcgtaatccagaaacatgatgccagtacc
ctccactatgatttccgcctggaaatagacggggtcctgaaaagctgggcagtccctaaa
gagccgccctcaaaagccggaataaaaaggctggccatccagaccgaagaccatcccctg
gaatacgctgattttgaaggggagatcccggaagggcattatggggcaggaaaggtcgaa
atctgggataaggggacctttaaactcaagaaatttgaagaaaaggaaatcattttcacg
cttgatggagaaaagcttcagggaggttatgttatgatcaaaacgaagttcgggaaagag
gggaagggatggctgctatttaagaaaaaggcagagtaa

DBGET integrated database retrieval system