KEGG   Methanosarcina sp. MTP4: MSMTP_1452Help
Entry
MSMTP_1452        CDS       T03850                                 

Definition
(GenBank) Aldehyde dehydrogenase
  KO
K22187  alpha-ketoglutaric semialdehyde dehydrogenase [EC:1.2.1.-]
Organism
metm  Methanosarcina sp. MTP4
Pathway
metm00040  Pentose and glucuronate interconversions
Brite
KEGG Orthology (KO) [BR:metm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    MSMTP_1452
Enzymes [BR:metm01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     MSMTP_1452
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh LuxC
Motif
Other DBs
NCBI-ProteinID: AKB24921
UniProt: A0A0E3L6F3
LinkDB All DBs
Position
complement(1881040..1882524)
Genome map
AA seq 494 aa AA seqDB search
MQEYGLLIGGEWTDSSTGETFDDMNPATLENLAVLQVAGIDDVNRAVEAAKAGFELWSKT
PPPKRAEVLFRAARILQGRKEELASLMTQEMGKVLAETRGDVQEAIDITYYAAGEGRRMF
GETTTSELRDKFCMTVLRPLGIVGLIAPWNFPIAIPAWKIMPALAAGNSIVFKPASDTPL
LAIKLVEILMEAGLPPGVINLVTGPGGTVGKAIVRHPDIRAISFTGSLETGKWIMGECAK
AMKRVSLELGGKNPVIVMDDADLDLALDGVLWGAFGTTGQRCTATSRLILHEKVREEFTA
RLLAKTRALRVGDGLLPETDVGPVINKAQLEKIERYVRIGQEEGAKLLIGGKLIAPETSG
LSGYFFEPTVFTDVNPDMRIAQEEIFGPVLSIITVSSFEEAIEVANNTQFGLSSAIYTEN
MGNAFRAVEMLETGITYVNAPTIGAEVHLPFGGVKGTGNGFREAGTDAIREFTEVKAVYI
DYSGKLQKAQIDTD
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgcaggagtatggactgcttataggtggagagtggacggattcttcaacaggagaaact
tttgatgatatgaacccggcaaccctggagaatttagctgtgctgcaggttgccggtata
gatgatgtgaacagggcagttgaagctgcaaaggcgggatttgagctgtggagcaagact
ccgcctccgaaaagggctgaggtgcttttcagggctgcccggatcttgcaggggcgaaag
gaagagcttgcctccctgatgacgcaggaaatgggaaaggtgcttgccgaaaccaggggg
gacgtgcaggaagccatcgatatcacatattacgccgcaggcgagggacgccggatgttc
ggggagaccacgacttcggaactccgggacaagttctgcatgaccgtgctccggcccctg
gggattgtgggcctgattgcaccctggaactttccgattgctattcctgcctggaaaatc
atgccagcccttgccgccggaaactcgatcgtcttcaagccggcaagcgataccccgctc
cttgcaatcaaactggtggaaatcctgatggaagccggtctgcccccgggggtcataaat
ctggtgaccgggcccggggggactgtcggaaaagcaatcgtccggcacccggatatccgg
gcaatttcctttaccggcagccttgagaccgggaaatggatcatgggggaatgcgcaaaa
gccatgaagcgggtctccctggaactgggtggcaaaaaccctgtgatagtcatggacgac
gccgacctggaccttgcccttgacggtgtcctctggggagccttcgggacaaccggccag
cgctgcaccgcaaccagccgcctgatcctgcacgaaaaggtaagggaagaatttaccgcc
cggctgcttgcaaagaccagagccctcagggtaggggacggcctccttcccgaaaccgac
gtgggacctgtgattaacaaagcccagctcgaaaagatcgaacgctacgtccggataggg
caggaggaaggagcaaaactgcttatcgggggaaagctcattgccccggaaacctctggc
ctctccggctatttcttcgaacccacggtctttaccgacgttaatccggacatgcgaatc
gcccaggaggaaatcttcggcccggtgctcagcatcatcacggtttcaagcttcgaagaa
gcaatagaagtcgcaaacaacacccaattcggcttatcctctgccatctacacggaaaac
atgggaaacgccttccgggcagtcgaaatgctcgaaaccgggatcacctacgtcaacgct
cccaccataggcgccgaagtccacctgcccttcgggggcgtaaaagggacaggaaacggt
ttccgggaagcagggaccgatgccataagggagtttacggaagtaaaagccgtgtacatc
gactacagcgggaagctgcaaaaggcccagatcgataccgattga

DBGET integrated database retrieval system