KEGG   Methanosarcina sp. MTP4: MSMTP_3122
Entry
MSMTP_3122        CDS       T03850                                 

Definition
(GenBank) Proline reductase for pyrrolysine biosynthesis
  KO
K16182  3-methylornithyl-N6-L-lysine dehydrogenase [EC:1.4.1.-]
Organism
metm  Methanosarcina sp. MTP4
Pathway
metm00300  Lysine biosynthesis
metm01100  Metabolic pathways
metm01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:metm00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    MSMTP_3122
Enzymes [BR:metm01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.-  
     MSMTP_3122
SSDB
Motif
Pfam: NAD_binding_2 NAD_binding_7 Mur_ligase UDPG_MGDP_dh_N
Other DBs
NCBI-ProteinID: AKB26591
UniProt: A0A0E3L7D7
LinkDB
Position
4052485..4053264
AA seq 259 aa
MALLTPEDLENIKKQLERADTAVSKVTRLNVKEVCKDLYGTSPHYESVGIVPVTSGNGII
GNFSDSLKVITDYFKFDSFVTEMPDVSGYYEAVESGAEIILMADDNTFLAHNLTNGKIGN
NQPCTGIIYADIVSRYRNADSKDVLVLGLGKVGFPGAEHLVNKGFNVYGCDPEKSLMKKA
IFKLGITPFDLKTPKKFSMIFEATPCADTIPENVLAEKCLVSTPGIPCGLSRELQEKYNV
DLLMEPLGIGTASMLYSVL
NT seq 780 nt   +upstreamnt  +downstreamnt
atggcacttttaactccggaagatctggaaaatattaaaaagcagcttgaaagagccgac
actgccgtcagcaaggtaacaaggcttaatgtgaaagaggtctgcaaagacctctacggc
acatccccccactatgaatcagtgggcattgttcccgtgacttcaggaaacgggatcata
ggtaacttctcagactcattgaaagtaattacggattacttcaagtttgacagttttgtg
acggaaatgcctgacgtgagcggctactatgaagccgtggaaagcggagcggaaataatc
cttatggctgacgacaacaccttccttgcccacaacctcacaaacggaaaaatcggaaac
aaccagccctgcaccggcattatctacgcggatatagtatccaggtaccgaaacgctgat
tcaaaggacgtactggtgctcgggcttgggaaggtcggtttccccggagccgaacacctc
gtgaataagggcttcaatgtttatggctgcgaccccgaaaaaagcctcatgaaaaaggct
atcttcaaactggggatcaccccctttgacctcaaaacccctaaaaagttctccatgata
tttgaagcgaccccctgtgcggacacaatccccgaaaacgtgctcgcagaaaaatgcctg
gtttcaacccccggaatcccctgtggcctttccagggaactccaggaaaaatacaacgtg
gatcttttgatggaacccctggggatagggaccgcttcaatgctgtattcggttctctga

DBGET integrated database retrieval system