KEGG   Methanobacterium sp. MZ-A1: BK008_02315Help
Entry
BK008_02315       CDS       T05317                                 

Gene name
porA
Definition
(GenBank) pyruvate ferredoxin oxidoreductase
  KO
K00169  pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
metn  Methanobacterium sp. MZ-A1
Pathway
metn00010  Glycolysis / Gluconeogenesis
metn00020  Citrate cycle (TCA cycle)
metn00620  Pyruvate metabolism
metn00633  Nitrotoluene degradation
metn00640  Propanoate metabolism
metn00650  Butanoate metabolism
metn00680  Methane metabolism
metn00720  Carbon fixation pathways in prokaryotes
metn01100  Metabolic pathways
metn01110  Biosynthesis of secondary metabolites
metn01120  Microbial metabolism in diverse environments
metn01130  Biosynthesis of antibiotics
metn01200  Carbon metabolism
Module
metn_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:metn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BK008_02315 (porA)
   00020 Citrate cycle (TCA cycle)
    BK008_02315 (porA)
   00620 Pyruvate metabolism
    BK008_02315 (porA)
   00640 Propanoate metabolism
    BK008_02315 (porA)
   00650 Butanoate metabolism
    BK008_02315 (porA)
  09102 Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    BK008_02315 (porA)
   00680 Methane metabolism
    BK008_02315 (porA)
  09111 Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    BK008_02315 (porA)
Enzymes [BR:metn01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     BK008_02315 (porA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR_N PFOR_II Transketolase_C NAPRTase TPP_enzyme_N
Motif
Other DBs
NCBI-ProteinID: AUB57266
UniProt: A0A2H4VGQ2
LinkDB All DBs
Position
475046..476194
Genome map
AA seq 382 aa AA seqDB search
MVQKVFTSNRAVAEAVKMAKPAVVPVYPITPQTTISEYLAQFVADGDLKAEYIRVESEHS
AISAALGASGAGVRVFTATSSQGLALMHEILFATAGMRSPIVLVNANRALSAPLSIWNDQ
QDTISERDSGWLQIYAENAQEALDAVLIAYRVAEDPEVLLPCMVCIDGYFLTHTVEPLDV
PSQEEVDQFLPPYKPYAFLDPENPMSIGTFTDPDYYMEARYAIEASMEKSKMVIAKANQE
FEKIFGRKYDLVETYQCDDAEIIIVAMGSVCGTIKDVIDTLRSEGEKVGLLKIRVFRPFP
REELKEILEKASKVAVLDKNISFGVGGVLYNEIKATTNANAYGFIAGLGGRDITPDYVKE
IVDKTKNPTGEVEWIGLKKEEV
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atggttcaaaaagttttcacatccaaccgagccgttgccgaagcggttaagatggccaaa
ccagcagtagttcctgtttatcccatcacaccccaaacaacaatttcagaatatctggcc
cagtttgtggccgatggggatttaaaagctgaatatatccgagtagaatcagagcacagc
gcaattagtgccgctttaggtgcttcaggagcaggtgttcgagtttttactgccacctca
tcccagggcctggccctgatgcacgaaatactgtttgctactgcgggtatgagaagcccc
attgttctggttaacgccaacagggcattatctgcacctctgagcatttggaatgatcag
caggacaccatatcagaacgtgactcaggatggcttcagatatatgctgaaaacgctcag
gaagccctggacgctgttttaatagcataccgggttgcagaagaccctgaagttctacta
ccctgcatggtatgtattgacgggtacttcttaacccacactgtggaaccactggatgtg
cccagccaggaggaagtggaccagttcttaccaccatataaaccatacgcattcctggac
ccggaaaatccgatgtccattggtactttcactgacccagattattatatggaagcccgt
tacgccatagaggcatccatggaaaaatctaaaatggtcatagccaaggccaatcaggaa
tttgagaagatatttggcaggaaatacgacctggttgaaacttaccagtgcgatgatgct
gaaattatcatagttgccatgggctctgtctgcggcactataaaagatgttatagacact
ctcagatcagaaggagaaaaagtaggcctcctgaaaatcagggtgttccgtcctttcccc
cgcgaagagttgaaggaaatcctggaaaaggcatccaaggtggctgttctggataagaat
atttcatttggagtgggaggagtgctttacaacgaaattaaagcaaccaccaacgctaat
gcctatggatttatcgctggattgggaggaagagacataaccccagactacgtcaaagaa
atcgttgataaaactaaaaaccccaccggagaggtggagtggatcggactcaaaaaggag
gaagtctaa

DBGET integrated database retrieval system