KEGG   Methanobacterium sp. BAmetb5: CIT02_10390Help
Entry
CIT02_10390       CDS       T05745                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
meto  Methanobacterium sp. BAmetb5
Pathway
meto00250  Alanine, aspartate and glutamate metabolism
meto00410  beta-Alanine metabolism
meto00430  Taurine and hypotaurine metabolism
meto00650  Butanoate metabolism
meto01100  Metabolic pathways
meto01110  Biosynthesis of secondary metabolites
meto01120  Microbial metabolism in diverse environments
meto02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:meto00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    CIT02_10390
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CIT02_10390
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CIT02_10390
   00430 Taurine and hypotaurine metabolism
    CIT02_10390
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    CIT02_10390
Enzymes [BR:meto01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     CIT02_10390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-ProteinID: AXV40692
UniProt: A0A347ANZ5
LinkDB All DBs
Position
2105081..2106469
Genome map
AA seq 462 aa AA seqDB search
MLSEKLDLGKLKRSEREHTTTYGSRYFSESIPKYEMPEDGMPAKAAYQLINEELNLDGNP
ALNLASFVTTWMEPEADQLIMDTMGKNYVDNDEYPQTSKIQDRVVNMLARLFNAPHECKS
VGTGTIGSSEAIMLGLLAHKWTWRKRREKEGQPADKPNIVMGADVHTVWEKFARYFDVEL
KLIPLTRDHYTITAQDVAQEVDENTIAVGAVIGTTFTGQMDPIKEINDLLVDIKKTKGWD
IPIHVDGASGGFVAPFIFPDMEWDFRLEQVKSINVSGHKYGLVYPGVGWIIFKDKSDLPE
DLIFDINYLGGLMPNYSLNFSKGSSTIIAQYYNLIRLGRKGYKDIMTNMFDNTLYLAGEL
ENSGKFELINKNIIVPLVAVTLKNADFTVFQLSEKLREKGWIVPAYTLPADAEDVAVLRI
VVKENFGRDMVEMLLEDLMEAYHKLEKEEPKAVKESNPTLLY
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
ttgttatcggaaaaattagacctggggaaactgaaaagatcagaaagggaacacaccacc
acctatggtagtcgctattttagtgaaagtatccccaaatacgagatgcctgaggatgga
atgccagctaaagcagcttaccagttgataaacgaggaactgaatctggatgggaacccc
gcccttaacctggccagttttgtaaccacctggatggaacccgaggctgaccagttaatc
atggataccatgggtaaaaactacgtggataacgatgaatacccccagacatccaaaatc
caggaccgggtggttaacatgttggcccggctctttaacgcaccccacgagtgcaaatca
gtgggaaccggaaccatcggatcctcagaggccatcatgctgggacttctggcccataaa
tggacctggagaaaacgaagggaaaaagagggccaacccgcggataaacccaacatagtc
atgggggccgatgtgcacacggtgtgggagaagttcgcccgctacttcgacgtggaactg
aagttaataccattaacccgggatcattacaccataactgcccaggatgtggcccaggaa
gttgatgaaaacaccatagccgtgggggcagtcatcgggacaaccttcactggacaaatg
gatccaatcaaggaaattaacgatttactggtggatatcaagaaaactaaaggatgggac
atacccatacacgtggatggggccagtggaggctttgtggcacccttcattttcccggac
atggaatgggactttagactggaacaggtgaaatccatcaatgtatcgggccataaatat
ggtctggtgtacccgggggtggggtggataatattcaaggacaaatctgacctgccggaa
gatctgatattcgatatcaactacctggggggattgatgcccaattactccctcaatttc
tccaagggaagcagtaccataatcgcccagtactataacctcatcagactgggcaggaag
ggttataaggacataatgaccaatatgttcgataacaccctttatctggccggggaactg
gaaaattctggtaaatttgagcttatcaataaaaacatcattgtgcccctggtggcggta
actctaaagaatgcagatttcactgttttccagctttcagaaaaactgcgggagaaggga
tggattgtaccggcctacaccctgcccgccgatgcagaggatgtggctgtcctgcgaatt
gtggttaaggaaaactttggccgggatatggtggaaatgctcctggaggatctgatggag
gcctaccataaactggaaaaagaggaacctaaagcggtgaaggaatctaaccccacctta
ctctattaa

DBGET integrated database retrieval system