KEGG   Methylibium sp. Pch-M: C1M51_05155Help
Entry
C1M51_05155       CDS       T05827                                 

Definition
(GenBank) shikimate kinase
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
metp  Methylibium sp. Pch-M
Pathway
metp00400  Phenylalanine, tyrosine and tryptophan biosynthesis
metp01100  Metabolic pathways
metp01110  Biosynthesis of secondary metabolites
metp01130  Biosynthesis of antibiotics
metp01230  Biosynthesis of amino acids
Module
metp_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:metp00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    C1M51_05155
Enzymes [BR:metp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     C1M51_05155
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_18 AAA_33 AAA_17 Cytidylate_kin AAA_22 Cytidylate_kin2 AAA AAA_16 AAA_28 Alpha_GJ KTI12 ABC_tran AAA_5
Motif
Other DBs
NCBI-ProteinID: QAZ38869
UniProt: A0A4P6H9B2
LinkDB All DBs
Position
complement(1104885..1105439)
Genome map
AA seq 184 aa AA seqDB search
MRLALVGLPGSGKSSVGRMLARKLGVSFTDSDTVIEQRIGEPIRSYFEREGEGRFRDLEQ
QVIGELCASRLGVLATGGGAVLREANRRALHEDCTVLYLRSSPEELHRRLRHDTQRPLLQ
VKDPRARLQQLYRERDPLYRETAHFVVETGRPTVQTLVGMILMQLELAGIVDASRVPSAV
EPPR
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
gtgcggctggcgctggtcggcctccccggttcggggaagtcctcggtcggccgcatgctg
gcgcggaaactcggcgtcagtttcacggattccgacacggtgatcgaacagcggatcggg
gaaccgatccgctcctacttcgagcgcgagggcgaaggccgatttcgcgatcttgagcag
caagtgatcggcgagctctgtgccagccggctcggtgtgctggccacgggcggcggtgcc
gtcttgcgggaggccaatcgccgtgccctgcacgaggactgcaccgtgctctacctgcga
tcctcgccggaagaactgcaccggcgcctgcgtcacgacacgcaaaggccgttgttgcag
gtcaaggatcctcgggcccggttgcagcagctctatcgcgagcgcgatcccctgtaccgc
gagactgcgcattttgtcgttgagacggggcggccaacggtccaaaccctggtgggcatg
atcctgatgcaactcgagctggccgggatcgtcgatgcgagccgggtgccctccgccgtc
gagccgccgcgctag

DBGET integrated database retrieval system