KEGG   Methylibium sp. Pch-M: C1M51_15205Help
Entry
C1M51_15205       CDS       T05827                                 

Definition
(GenBank) aldehyde ferredoxin oxidoreductase
  KO
K03738  aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
metp  Methylibium sp. Pch-M
Pathway
metp00030  Pentose phosphate pathway
metp01100  Metabolic pathways
metp01120  Microbial metabolism in diverse environments
metp01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:metp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    C1M51_15205
Enzymes [BR:metp01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     C1M51_15205
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AFOR_C AFOR_N
Motif
Other DBs
NCBI-ProteinID: QAZ40665
LinkDB All DBs
Position
3169679..3171526
Genome map
AA seq 615 aa AA seqDB search
MSWAGKILRVNLTAGTVSSEPLNMEWARAYLGSRGLATKYLVSEIDPKVDPLAPENKIIW
ATGPLTGTMASTGGRYTVVTKGPLTGAIACSNSGGYWGAELKFSGWDMVIFEGKSAKPVY
LSIEDDKAELRDASHLWGKSVWQTEEIIKKQHQDPLTRVSSIGLAGENGVLYAAVVNDLH
RAAGRSGVGAVMGSKNLKAIAVRGTQGVGNVANPKEFMKVTFEKKKILADNAVTGQGLPT
YGTQVLMNVINEIGASPTRNHRDVQFEGAKDISAEAMATPRKTDGKKPLVTNQACFGCTI
ACGRIQKIDQSHFSVENKPQYWGASGGLEYEAAWALGNANGVNDLDALQYANVLCNEQGM
DPISFGATIGAVMELYEMGVLTKEQLGTDAPFGSARALVHFAEMTAQGVGFGKEIGLGSA
RLTAKYGHPDLSMSVKGQEFPAYDSRGIQGMGLAYATSNRGACHLRGYTVASEVLGIPVK
TDPLVAEGKPELVKAFQDATAAFDSAGICIFTSFAWGLADVQPQVAAACGEEFTLEKLNE
IGERVWNMERDFNNQAGFTAKDDTLPKRLLTEPAKTGPAKGLVNKLPEMLPQYYEVRGWD
AGGQLKPETRARLGL
NT seq 1848 nt NT seq  +upstreamnt  +downstreamnt
atgtcttgggctggaaagatccttcgcgtcaacctcaccgccggcaccgtttcctcggag
ccgctgaacatggaatgggcgcgcgcctacctgggctcgcgcggcctggccaccaagtac
ctcgtcagcgagatcgaccccaaggtcgatccgctcgcgcccgagaacaagatcatctgg
gcgaccggcccgctgaccggcaccatggcctcgaccggcggccgctacaccgtggtcacc
aagggcccgctgaccggcgcgatcgcctgctccaactcgggcggctactggggcgccgag
ctcaagttctcgggctgggacatggtgatcttcgaaggcaagtcggccaagccggtctac
ctgtcgatcgaggacgacaaggccgagctgcgtgacgcttcccacctgtggggcaagagc
gtctggcagaccgaggagatcatcaagaagcagcaccaggacccgctgacccgcgtgtcc
agcatcggcctggccggcgagaacggcgtgctgtacgcggcggtggtgaacgacctgcac
cgcgcggccggccgctcgggcgtgggcgcggtgatgggctcgaagaacctgaaggccatc
gcggtgcgcggcacccagggcgtcggcaacgtcgcgaacccgaaggaattcatgaaggtg
accttcgagaagaagaagatcctcgccgacaacgccgtcaccggccagggcctgccgacc
tacggcacccaggtgctgatgaacgtgatcaacgagatcggcgcctcgccgacgcgcaac
caccgcgacgtgcagttcgagggcgccaaggacatctccgccgaggcgatggccacgccg
cgcaagaccgacggcaagaagccgctggtcaccaaccaggcctgcttcggctgcaccatc
gcctgcgggcgcatccagaagatcgaccagagccacttctcggtcgagaacaagccgcag
tactggggcgcctccggcggcctggagtacgaggcggcctgggcgctgggcaacgccaac
ggcgtgaacgacctcgacgcgctgcagtacgccaacgtgctgtgcaacgagcagggcatg
gacccgatctccttcggcgccaccatcggcgcggtgatggagctctacgagatgggcgtg
ctgaccaaggagcaactcggcaccgacgcgccgttcggctcggcgcgcgccctggtgcac
tttgccgagatgaccgcgcagggcgtgggcttcggcaaggagatcggcctgggctcggcg
cggctgaccgcgaagtacggccaccccgacctgtcgatgagcgtcaagggccaggagttc
ccggcctacgacagccgcggcatccagggcatgggcctcgcgtatgccacctccaaccgt
ggcgcctgccacctgcgcggctacacggtcgcctcggaagtgctgggcatcccggtcaag
accgacccgctggtcgccgagggcaagccggagctggtgaaggccttccaggacgccacc
gccgccttcgactcggccggcatctgcatcttcaccagcttcgcctggggcctggccgac
gtgcagccgcaggtcgcggccgcctgcggcgaggagttcacgctggagaagctgaacgag
atcggcgagcgcgtgtggaacatggagcgcgacttcaacaaccaggccggcttcaccgcc
aaggacgacacgctgcccaagcgcctgctgaccgaaccggcgaagaccggcccggccaag
ggcctggtgaacaagctgccggagatgctgccgcagtactacgaggtgcgcggctgggac
gccggcggccagctcaagcccgagacacgcgcacgcctgggcctatga

DBGET integrated database retrieval system