KEGG   Methylibium sp. Pch-M: C1M51_17220Help
Entry
C1M51_17220       CDS       T05827                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
metp  Methylibium sp. Pch-M
Brite
KEGG Orthology (KO) [BR:metp00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    C1M51_17220
Enzymes [BR:metp01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     C1M51_17220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_oxidored FAD_binding_2 Glutaredoxin DAO HI0933_like FAD_binding_3 AlaDh_PNT_C NAD_binding_8 Thi4 NAD_binding_7 FMO-like K_oxygenase
Motif
Other DBs
NCBI-ProteinID: QAZ41021
UniProt: A0A4P6GXQ7
LinkDB All DBs
Position
3606436..3608007
Genome map
AA seq 523 aa AA seqDB search
MLDTALKTQLKSYLDKVEHPIDIVASVDEGEKSQELLALLNDIAELSARITLSVRRDDAE
RKPSFSLNRPGAQIGLRFAGLPMGHEFTSLVLALLQVGGHPSKAAAEVIEQVKGLEGDYL
FETFFSLSCQNCPDVVQALNLMAVLNPNIRHVAIDGALFQAEVEQRQVMAVPTIFLNGQS
FGQGRMGLEEIVAKLDTGAVKREAAKLSAKAPYDVLIVGGGPAGAAAAIYAARKGIRTGL
AAERFGGQVLDTLAIENFISVKETDGPKFAVALEEHVKAYDVDIMNLQRAEALVPGQPGE
PSEVHFAGGAVLKASTVIIATGARWRDMNVPGEQQYRTKGVTYCPHCDGPLFKGKRVAVI
GGGNSGVEAAIDLAGVVAHVTLLEFAAELRADAVLQRKLHSLPNVKVITQAQTTEVTGDG
HKVNGLTYTDRASGEVHQLALEGVFVQIGLLPNTDWLKGTVELSKHGEVIVDARGQTSVP
GVFAAGDVTTVPYKQIVIALGEGSKAALSAFDHLIRSTAPALA
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atgctggacactgccctcaagacccaactgaagagctatctcgacaaggtcgaacacccg
atcgacatcgtggcctcggtcgacgaaggcgagaagtcgcaggaactgctggccttgctg
aacgacatcgccgaactctcggcccgcatcacgctctcggtgcgccgcgacgacgccgag
cgcaagccttcgttctccctgaaccgtccgggcgcgcagatcggcctgcgtttcgccggc
ctgccgatgggccatgaattcacgtcgctggtgctggccctgctgcaggtcggcggccac
ccttcgaaggcggcggcggaggtgatcgagcaggtcaagggactcgaaggcgactacctg
ttcgagaccttcttctccctgagctgccagaactgccctgacgtcgtgcaggcgctcaac
ctgatggcggtgctgaacccgaacatccgccacgtggcgatcgacggcgcgctgttccag
gccgaggtcgaacagcgccaggtgatggccgtgccgacgatcttcctcaacgggcagagc
ttcggccagggccgcatgggcctggaagagatcgtcgcgaagctcgacaccggcgccgtg
aagcgcgaggccgcgaagctcagcgccaaggcgccgtacgacgtcctgatcgtcggcggc
ggcccggccggcgcggccgcggccatctacgcggcacgcaagggcatccgcaccggactc
gcggccgagcgcttcgggggccaggtgctggacacgctggcgatcgagaacttcatctcg
gtcaaggagaccgacggcccgaagttcgcggtcgcgctggaggagcacgtcaaggcctac
gacgtggacatcatgaacctgcagcgtgccgaggcgctggttcccggtcagccgggcgaa
ccgagcgaagtgcatttcgcgggaggtgcggtgctgaaggcgagcacggtgatcatcgcc
accggcgcgcgctggcgcgacatgaacgtgcccggcgagcagcagtaccgcaccaagggc
gtgacctactgtccgcactgcgacgggccgctgttcaagggcaagcgcgtggcggtgatc
ggcggtggcaattccggcgtcgaggccgcgatcgacctggccggcgtggtggcgcatgtc
acgctgctcgagtttgccgcggaattgcgcgccgatgcggtgctgcagcgcaagctgcac
agcctgcccaacgtgaaagtcatcacccaggcgcagacgaccgaggtcaccggtgatggg
cacaaggtcaatggcctgacgtacaccgatcgcgcctccggcgaggtgcaccagctggcg
ctcgagggcgtgttcgtgcagatcggcctgctgcccaacaccgactggctcaagggcacg
gtggaactgtccaagcacggcgaggtgatcgtcgatgcccgcggccagacctcggtgcct
ggtgtgttcgcggcgggtgacgtgacgaccgtgccctacaagcagatcgtgatcgcgctc
ggcgagggctcgaaagcggcgctgagcgccttcgaccacctgatccgctcgacagcgccg
gcgctcgcctga

DBGET integrated database retrieval system