KEGG   Methyloversatilis sp. RAC08: BSY238_1389Help
Entry
BSY238_1389       CDS       T04449                                 

Definition
(GenBank) short chain dehydrogenase family protein
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
metr  Methyloversatilis sp. RAC08
Pathway
metr00061  Fatty acid biosynthesis
metr00780  Biotin metabolism
metr01100  Metabolic pathways
metr01130  Biosynthesis of antibiotics
metr01212  Fatty acid metabolism
Module
metr_M00083  Fatty acid biosynthesis, elongation
metr_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:metr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    BSY238_1389
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    BSY238_1389
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    BSY238_1389
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:metr01004]
    BSY238_1389
Enzymes [BR:metr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     BSY238_1389
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     BSY238_1389
Lipid biosynthesis proteins [BR:metr01004]
 Fatty acid synthase
  Component type
   BSY238_1389
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short
Motif
Other DBs
NCBI-ProteinID: AOF80910
UniProt: A0A1B3LJ84
LinkDB All DBs
Position
1505479..1506258
Genome map
AA seq 259 aa AA seqDB search
MANSNKGVLSGKRALIIGIANENSIAWGCARALHAAGAELAITYLNDKAKPFVEPLAQQL
GAELLLPLDVSVAGQMEDVFATIQGTWRRLDIALHSIAFAPREALAGGLIDCPADGFAKA
MDVSCHSFIRMARLAAPLMTDGGSLFAMSYMGANKVVPNYNVMGPCKAALEASVRYLAFE
LGPKGIRVHAISPGPLRTRAASGLKEFDELLYEAVQKSPISGLVDIDDVGVALTYLATDY
ARRLTGSTFYVDGGHNIMA
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atggctaacagcaacaagggcgttctcagcggcaagcgcgcgctgatcatcggcatcgcc
aacgaaaactcgatcgcctggggctgcgcgcgtgcgttgcacgcggcgggtgccgaactg
gcgatcacctatctcaacgacaaggcgaaaccctttgtcgaaccgctggcgcagcaactc
ggcgccgaactgctgctgccgctcgacgtgtcggtggcgggtcagatggaagacgtgttc
gcgacgattcagggcacatggcgtcgcctggacattgcgctgcactcgatcgcgtttgca
cccagggaggcactggccggcggtctgatcgattgcccggccgatggattcgccaaggcc
atggacgtgtcgtgtcattccttcatccgcatggcccggctggctgctccgctgatgacc
gacggcggctcgctgttcgcgatgagctatatgggtgccaacaaggtggtgcccaactac
aacgtgatgggcccgtgcaaggcggcgctcgaggcctcggtgcgctatctggcgttcgag
ctcgggccgaagggcatccgcgtgcatgccatttcgccggggccgctgcgcacccgggcg
gcgtccggactcaaggaattcgatgaactgttgtatgaggcggtccagaagtcgccgatc
agcggactcgtcgacatcgacgatgtgggcgtcgccctgacctatctggccaccgattac
gcgcgccgacttaccggctcgaccttctacgtggacggcggccacaacatcatggcttga

DBGET integrated database retrieval system