KEGG   Methyloversatilis sp. RAC08: BSY238_156Help
Entry
BSY238_156        CDS       T04449                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
metr  Methyloversatilis sp. RAC08
Brite
KEGG Orthology (KO) [BR:metr00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BSY238_156 (ahpF)
Enzymes [BR:metr01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     BSY238_156 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 FAD_oxidored HI0933_like Glutaredoxin DAO FAD_binding_3 Thi4 K_oxygenase AlaDh_PNT_C NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: AOF81264
UniProt: A0A1B3LKA8
LinkDB All DBs
Position
complement(161043..162632)
Genome map
AA seq 529 aa AA seqDB search
MLDATLKGQLQAYLTKLVHPIELVASLDDSDASRELQSLLAEIAELSNLITLVEKRDDDE
RKPSFSINRKGGDMSLRFAAIPLGHEFTSLVLALLQAGGHPPKVDQEVIDQIKALDADFH
FEVFMSLSCHNCPDVVQALNLMAVLNPRVSAVTIDGALFQKEVEERQIMAVPMIFLNGQH
FGQGRMTIEEILPKLDTKVAEREAEKVSARAPFDVLVVGGGPAGTAAAIYAARKGIRTGL
VAERFGGQVMDTLGIENFISVKETEGPKLVAALEEHVKAYDIDVMNLQRVEKLVPAAESG
DGYIHLTLASGAKLKSRSVILSTGARWREINVPGEREYRNHGVAYCPHCDGPLFKGKNVA
VIGGGNSGVEAAIDLAGVVGHVTLIEFDKQLRADAVLQRKLHSLPNVKVITHAQTKDIVG
DGKKVNGLNYIDRASGDLNHVDLEGVFIQIGLVPNTEWLKGSSMALTKYGEIDIDARCET
SIAGVFAAGDVTTVPYKQIIIAMGEGSKAAISAFDYLIRHSAPEAAAAA
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgctcgatgccaccctcaagggccagttgcaggcctacctcacgaagcttgtccacccg
atagagctggtggcgtcgctggacgacagcgatgcttcgcgcgaactgcaatcactgctg
gcggaaatcgccgaactgtcgaacctgatcacgctggtcgagaagcgcgacgacgacgag
cgcaagccctcgttctcgatcaatcgcaagggcggcgacatgagcctgcgcttcgcggcc
atcccgctcggccatgaattcacgtcgctggtgctggcgctgctgcaggccggcggccat
ccacccaaggtggatcaggaagtgatcgatcagatcaaggcgctcgacgccgacttccac
ttcgaagtcttcatgagtctgtcctgccacaactgccctgacgtggtgcaggcgctcaac
ctgatggctgtgctgaacccgcgcgtcagtgcggtcacgatcgacggtgcgctgttccag
aaggaagttgaagagcgccagatcatggcggttccgatgatcttcctgaacggtcagcac
ttcggtcagggccgcatgacgatcgaggaaatcctgcccaagctggacaccaaggtcgcc
gagcgcgaagccgaaaaggtgtcggcccgcgcaccgttcgacgtgctggtcgtcggcggc
ggtccggccggtacggcagcggcgatctacgcggcgcgcaagggcatccgcaccgggctg
gttgccgagcgcttcggcggtcaggtgatggacacgctgggcatcgagaacttcatttcg
gtgaaggaaaccgaagggcccaagctggtcgccgcgctggaagagcacgtgaaggcctac
gacattgacgtgatgaacctgcagcgggtcgaaaagctcgtgccggcagcggagtcgggc
gacggttacatccacctgacgctggccagtggcgccaagctgaagagccgctcggtcatc
ctgtcgaccggcgcacgctggcgcgaaatcaacgtgccgggcgagcgcgaataccgcaat
cacggcgtggcctactgcccgcactgcgatggcccgctgttcaagggcaagaacgtcgcc
gtgatcggtggtggcaattccggtgtcgaggcggcgatcgacctggccggcgtggtgggt
catgtgacgctgatcgaattcgacaagcagctgcgtgccgatgccgtgctgcagcgcaag
ctgcacagcctgccgaacgtcaaggtcatcacgcatgcgcagacgaaggacatcgtcggc
gacggcaagaaggtcaatggcctgaactacatcgatcgcgcgagcggcgacctcaaccat
gtcgatctggagggcgtgttcatccagatcggtctggtaccgaacaccgagtggctgaag
ggctcctcgatggcgctgaccaagtacggtgaaatcgacatcgatgcacgctgcgaaacg
tcgattgcgggcgtgttcgcggcaggtgacgtgaccaccgtgccgtacaagcagatcatc
atcgccatgggtgaagggtcgaaggcggcgatcagcgcgttcgattacctgatacgccat
tcggcgccggaggcggccgccgcggcctga

DBGET integrated database retrieval system