KEGG   Methyloversatilis sp. RAC08: BSY238_1872Help
Entry
BSY238_1872       CDS       T04449                                 

Gene name
cbbL1
Definition
(GenBank) ribulose bisphosphate carboxylase large chain, chromosomal
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
metr  Methyloversatilis sp. RAC08
Pathway
metr00630  Glyoxylate and dicarboxylate metabolism
metr01100  Metabolic pathways
metr01120  Microbial metabolism in diverse environments
metr01200  Carbon metabolism
Module
metr_M00165  Reductive pentose phosphate cycle (Calvin cycle)
metr_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
metr_M00612  Anoxygenic photosynthesis in purple bacteria
Brite
KEGG Orthology (KO) [BR:metr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    BSY238_1872 (cbbL1)
Enzymes [BR:metr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     BSY238_1872 (cbbL1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: AOF81085
UniProt: A0A1B3LJQ9
LinkDB All DBs
Position
1977192..1978658
Genome map
AA seq 488 aa AA seqDB search
MGDMNTPTQITDAKKRYSAGVLKYAQMGYWDSDYEPKATDILALFRITPQDGVDPIEAAA
AVAGESSTATWTVVWTDRLTACDMYRAKAYRVDPVPNTPGQFFAYVAYDLSLFEEGSITN
VAASIIGNVFSFKPLKAARLEDMKFPVAYVKTFAGPPTGIIVERERLDKFGRPLLGATTK
PKLGLSGRNYGRVVYEGLKGGLDFMKDDENINSQPFMHWRDRFLFVMDAVNKASAATGEV
KGSYLNVTAGTMEEMYRRADFAKDLGSVIVMVDLVVGYTAIQSLSHWCRQNDMILHLHRA
GHGTYTRQKNHGVSFRVIAKWMRMAGVDHIHAGTAVGKLEGDPMTVQGYYNVCRDTHTEV
DLQRGIYFDQDWGALKKVMPVASGGIHAGQMHQLIDLFGDDVVLQFGGGTIGHPQGIQAG
ATANRVALEAMVLARNEGRNIAEEGPQILRDAAKWCSPLAAALDTWGDITFNYASTDTSD
YAPTPSVA
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgggcgacatgaacaccccgacgcagatcaccgatgcgaagaagcgctactcggccggc
gtcctgaaatatgcgcagatgggctactgggacagcgactacgaaccgaaggcgaccgac
atcctcgcgctgttccgcatcacgccgcaggacggcgtcgatccgatcgaagccgccgcc
gcggtggcaggcgaatcgagcaccgcgacctggaccgtcgtgtggaccgaccgcctgacc
gcctgcgacatgtaccgcgccaaggcctatcgcgtcgatccggtacccaacacgccgggt
cagttcttcgcctacgtcgcctacgacctgagcctgttcgaggaaggttcgatcaccaac
gtcgccgcatcgatcatcggcaacgtgttcagcttcaagccgctgaaggcggcgcggctg
gaggacatgaagtttccggtcgcctacgtgaaaacctttgccggcccgccgaccggcatc
atcgtggagcgtgagcggctggacaaattcggccgcccgctgctcggcgcaacgaccaag
cccaagctaggcctcagtggccgcaattacggccgcgtggtgtatgaaggcctgaagggc
gggctggatttcatgaaggacgacgagaacatcaactcgcagcccttcatgcactggcgc
gaccgcttcctgttcgtcatggacgcggtcaacaaggccagcgccgcgaccggcgaagtc
aagggcagctatctgaacgtcaccgccggcacgatggaagaaatgtaccggcgcgccgac
ttcgcgaaggatctgggctcggtcatcgtcatggtcgacctggtggtcggctacacggcg
atccagtcgctgtcgcactggtgccggcagaacgacatgatcctgcacctgcaccgcgcc
ggccacggcacctacacgcggcagaagaaccacggcgtgagcttccgcgtcatcgccaag
tggatgcgcatggccggggtcgaccacatccacgccggcaccgcagtgggcaagctggaa
ggcgacccgatgacggtgcagggctattacaacgtgtgccgcgacacgcacaccgaggtc
gacctgcagcgcggcatctacttcgaccaggactggggcgcactgaagaaggtgatgccg
gtcgcgtccggcggcatccacgccggccagatgcaccagctgatcgacctgttcggcgac
gacgtggtgctgcagttcggcggcggcacgatcggccacccgcagggcatccaggccggt
gccaccgccaatcgcgtggcgctggaagccatggtgctggcgcgcaacgaaggccggaac
atcgccgaagaaggcccgcagatcctgcgcgacgccgcgaagtggtgttcgcccctggcc
gccgctctcgatacctggggcgacatcaccttcaactatgcgtcgaccgacacctcggac
tatgcgccgacgccgtcggtggcttga

DBGET integrated database retrieval system