KEGG   Methyloversatilis sp. RAC08: BSY238_2542Help
Entry
BSY238_2542       CDS       T04449                                 

Gene name
hisE
Definition
(GenBank) phosphoribosyl-ATP pyrophosphatase
  KO
K01523  phosphoribosyl-ATP pyrophosphohydrolase [EC:3.6.1.31]
Organism
metr  Methyloversatilis sp. RAC08
Pathway
metr00340  Histidine metabolism
metr01100  Metabolic pathways
metr01110  Biosynthesis of secondary metabolites
metr01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:metr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    BSY238_2542 (hisE)
Enzymes [BR:metr01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.31  phosphoribosyl-ATP diphosphatase
     BSY238_2542 (hisE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PRA-PH MazG
Motif
Other DBs
NCBI-ProteinID: AOF80385
UniProt: A0A1B3LHR5
LinkDB All DBs
Position
2738750..2739073
Genome map
AA seq 107 aa AA seqDB search
MIDIEVLHRVAQTIAERKLAEPGSSYVSSLLHKGTDAICKKVIEEAAETIMASKDGDAGH
LVKEVCDLWFHSMVLLAHHGLTVDDVLHEFRRREGISGLDEKRSRTT
NT seq 324 nt NT seq  +upstreamnt  +downstreamnt
atgatcgatattgaagtgttgcatcgagtggcgcagaccatcgccgaacgcaagctggct
gaacccggctcgtcgtatgtgtcgtcgctgctgcacaagggcaccgacgcgatctgcaag
aaggtgatcgaagaagcggcggaaaccatcatggcttcgaaggatggcgacgccggtcac
ctggtgaaggaagtgtgcgacctctggttccacagcatggtgctgcttgcgcaccacggc
ctgacggtcgatgacgtgctgcacgaatttcgtcgccgcgaaggcatttccggtctggac
gaaaaacgttcgcgcacgacctga

DBGET integrated database retrieval system