KEGG   Methyloversatilis sp. RAC08: BSY238_2762Help
Entry
BSY238_2762       CDS       T04449                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase family protein
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
metr  Methyloversatilis sp. RAC08
Pathway
metr00620  Pyruvate metabolism
metr00680  Methane metabolism
metr01100  Metabolic pathways
metr01120  Microbial metabolism in diverse environments
metr01200  Carbon metabolism
Module
metr_M00168  CAM (Crassulacean acid metabolism), dark
metr_M00346  Formaldehyde assimilation, serine pathway
Brite
KEGG Orthology (KO) [BR:metr00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BSY238_2762
  Energy metabolism
   00680 Methane metabolism
    BSY238_2762
Enzymes [BR:metr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     BSY238_2762
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AOF82540
UniProt: A0A1B3LNV3
LinkDB All DBs
Position
complement(2971600..2974437)
Genome map
AA seq 945 aa AA seqDB search
MPAGSVVPDLTDLLEGLHVNQQAQTPVATHERAAHDKDQPLFDDIRLLGRMLGDVVREQE
GSRMFEIIENVRQLCVRFRRDDDLEARAELAKLLNSLSDDDTIIVVRAFSYFLHLANIAE
DQHHIRRARAHAIAGDAPRPGTLANALGKALDAKVPAEEILGFFRDALVVPVLTAHPTEV
QRKSILSQEMKIARLIDERDRTRLTPEELAEHDEAVRRTITSLWQTRMLRRTRLSVADEV
INGLSFYDYTFLRELPRVYNAVEDQLEAAFPEHKRVIGSFLRMGSWIGGDRDGNPFVTAD
VLRSTLRVQSARALDYYLTQVHILDTDLCSTMMLNNVSDELRVLAATAPDKSPHREDELY
RRALAGIYARLAATARTLDQHEALWKAVGDADPYRNAAEFVRDLDVIHDSLIGHKSRLIA
RGRLRRLRHAARVFGFHLAALDLRQNSDVHERVIAELLANAHVCNNYLELREEQRIEILI
NELGTPRPLTSSFMQFSEETAGELAIARTAAQMHALYGPEALPNYIISKADGVSDMLEVA
LILKEVGLLNVHERRAAMNIIPLFETIGDLRNAPRVMDRIFTIPIWRVLLDARSTTQEVM
LGYSDSNKDGGFLTSGWELYKAETKLVQVFKRHGVRLRLFHGRGGSVGRGGGPSFQAILA
QPAGAVQGQIRVTEQGEVIASKYSNPDVGRRNLEVLAAATFEATLLGKREGDAPPEFTDA
MEELSGYAFKAYRNLVYETEGFEKYFWESTVISEIAELNIGSRPASRKKGQKIEDLRAIP
WVFSWSQCRLMLPGWYGFGTAVNEYRAKHADGLARLQAIVHEWPFFATLISNIDMVLSKT
DIAIASRYAELVEDEALRTAIFSRIRAEWQATLDAVSQITGAPELLSTNPLLARSIRNRF
PYMEPLNHLQVELLRRFRSGNRHERTRRSIHLTINGVAAALRNSG
NT seq 2838 nt NT seq  +upstreamnt  +downstreamnt
atgccggccggcagcgttgttcccgacctgaccgatcttctggaaggattgcacgtgaat
caacaggcccagacgcccgttgcgacgcacgaacgcgccgcacacgacaaggaccagccg
ctgttcgacgatatccgcctgctcggccgcatgctgggcgacgtggtacgcgagcaggaa
ggcagccgcatgttcgaaatcatcgagaacgtgcgccagctgtgcgtgcgcttccgccgc
gatgacgacctcgaagcgcgcgccgaactggccaagctgctgaacagcctgagcgacgac
gacaccatcatcgtggtgcgcgccttcagctacttcctgcatctggccaacatcgcggaa
gatcagcatcacatccggcgcgcccgggcgcacgccatcgccggcgacgcacctcggccc
ggtacgctggccaatgcgctgggcaaggcgctcgacgccaaggtgccggcggaagagatc
ctcggcttcttccgcgacgcgctggtggtgccggtgctgaccgcgcatccgaccgaggtg
cagcgcaagagcatcctcagccaggaaatgaagattgcccggctgatcgacgagcgcgac
cgcacccgcctgaccccggaagagctggccgaacacgacgaagcggtgcggcgcaccatc
acttcgctgtggcagacccgcatgctgaggcgcacccgcctttcggtcgccgacgaggtg
atcaacgggctgtccttctacgactacaccttcctgcgcgaactgccgcgcgtctacaac
gcggtcgaggaccagctcgaagcggcctttccggagcacaagcgcgtcatcggcagcttt
ctgcgcatgggctcctggatcggcggcgaccgcgacggcaaccccttcgtcaccgccgac
gtgctgcgctcgacgctgcgcgtgcagtcggcccgcgcgctcgactattacctgacgcag
gtgcacatcctcgataccgacctgtgttcgacgatgatgctgaacaacgtcagcgacgaa
ttgcgcgtgctggccgccactgcaccggacaagtcgccgcaccgcgaggacgaactgtac
cggcgcgcgctggccggcatctatgcccggctggccgccaccgcgcgcacgctcgaccag
catgaggcgctgtggaaggcggtcggcgacgccgatccctatcgcaacgccgccgaattc
gtgcgtgacctcgacgtgatccacgattcgctgatcggccacaagtcgcgcctgatcgca
cgcggccggttgcgccgcctgcgccacgcggcacgcgtgttcggcttccatctggctgcg
ctcgacctgcggcagaactccgatgtgcatgagcgcgtgatcgccgaactgctggccaac
gcgcacgtgtgcaacaactacctcgagctgcgcgaagagcagcgcatcgagatattgatc
aacgagctgggcacgccgcgaccgctgacttcgagtttcatgcagttttcggaagagacc
gcgggcgagctggcgatcgcccgcacggcggcgcagatgcatgcgctgtacggcccggaa
gcgctgccgaactacatcatttccaaggccgacggcgtgtccgacatgctggaagtggcg
ctcatcctgaaggaagtcgggctgctgaacgtgcatgagcggcgcgccgcgatgaacatc
attccgctgttcgaaaccatcggcgacctgcgcaatgcaccgcgcgtgatggaccgcatc
ttcaccatcccgatctggcgcgtgctgctcgacgcccgctcgacgacgcaggaagtgatg
ctgggctattccgattcgaacaaggacggcggcttcctgacttcgggctgggagctttac
aaggcggaaacgaagctggtgcaggtgttcaaacggcacggcgtgcggctgcgcctgttc
cacggtcgcggcggttcggtcggccggggtggcgggccgagcttccaggccatccttgcg
cagccggccggcgcggtgcagggccagatccgcgtcaccgaacagggcgaggtgatcgcg
tcaaagtactccaacccggatgtcggccgccgcaacctggaagtgctggccgccgccacc
ttcgaggcgacgctgctgggcaagcgcgaaggcgatgcgccgccggaattcaccgacgcg
atggaagagctgtcaggctatgccttcaaggcctaccgcaatctggtgtacgaaaccgaa
ggtttcgagaagtacttctgggaatcgacggtcatttcggaaatcgccgagctgaacatc
ggctcgcgcccggcctcgcgcaagaagggccagaagatcgaagacctgcgcgcgattcca
tgggtgttttcgtggtcgcagtgccgcctcatgctgcccggctggtacggcttcggcacc
gcggtgaacgaatatcgcgccaagcacgccgacggtctggcgcggctgcaggccatcgtg
cacgagtggcccttcttcgcgacgctgatttccaatatcgacatggtgctgtcgaagacc
gacatcgcgatcgccagccgctacgccgagctggtcgaggacgaggcgctgcgcacggcg
attttctcgcgcatccgcgccgagtggcaggccacgctggacgcggtgagccagatcacc
ggcgcgccggaactgctgtccaccaatccgctgcttgcccgctcgatccgcaatcgcttc
ccctacatggagccgctgaaccacctgcaggtcgaactgctgcgccgtttccgcagcggc
aaccgccacgagcgcacgcgccggtcgatccacttgacgatcaacggggtggctgcggcg
ctgcgcaacagcgggtag

DBGET integrated database retrieval system