KEGG   Methyloversatilis sp. RAC08: BSY238_618Help
Entry
BSY238_618        CDS       T04449                                 

Definition
(GenBank) hypothetical protein
  KO
K03738  aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
metr  Methyloversatilis sp. RAC08
Pathway
metr00030  Pentose phosphate pathway
metr01100  Metabolic pathways
metr01120  Microbial metabolism in diverse environments
metr01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:metr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BSY238_618
Enzymes [BR:metr01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     BSY238_618
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AFOR_C AFOR_N
Motif
Other DBs
NCBI-ProteinID: AOF82890
UniProt: A0A1B3LPW4
LinkDB All DBs
Position
complement(671902..673749)
Genome map
AA seq 615 aa AA seqDB search
MAWTRKILRVNLTDRTCTSEPLNMEWAHDYLGQRGLATKYLASEIDPKVDPLSPDNKIIW
ATGPLTGTMASTGGRYSVVTKGPLTGAIACSNSGGYFGAELKFAGWDMVIIEGRASSPVY
LSIENDKVELRDAAHLWGKTVWETEGQIKSEHQDPQIRVSCIGRTGENGVLYAAIVNDLH
RAAGRSGVGAVAGSKNLKAIAVRGTLGVGNIANPKEFMKVTFEKKKILKENAVTGQGLPT
YGTQVLMNVINEIGAMPTRNHKDVQFEGARKISAEAMHEPRESDGKAQLVNNQACFGCTI
ACGRISKIDATHYTVVNSPKYWGASGGLEYEAAWALGCANGVDDLDALQYATMLCNEDGF
DPISFGATIGAVMELYEMGVLTKEEIGIEAPFGSGKALTYLTEITARGEGFGKIIGLGSK
RLCEKYGHPELSMSVKGQEFPAYDARAVQGMGLTYATSNRGACHLRSYTISSEVLGIPVK
TDPLTTEGKPALVKAFQDATAVVDSTGLCVFTTFAWALSDIQPQLQAACEGDWSMEKLDL
MGERIWNMERQFNNAAGFTRKDDDLPARLKTEAAKVGPAKGLVSGIDKMIPEYYDLRGWD
TEGRPTAETVARLGL
NT seq 1848 nt NT seq  +upstreamnt  +downstreamnt
atggcatggacacgtaagattctccgcgtaaatctcaccgaccgcacctgtacgagcgag
ccgctcaacatggagtgggcacacgactatctcggtcagcgcggtctggcgacgaagtac
ctggcgtcggaaatcgatccgaaggtcgatccgctgtcgccggacaacaagatcatctgg
gcgaccggcccgctgaccggcacgatggcatccaccggtggccgctattcggtggtcacc
aagggcccgctgaccggtgccattgcctgttcgaactccggcggctacttcggcgccgaa
ttgaagttcgccggctgggacatggtcatcatcgagggccgggcgtcgagcccggtctat
ctgtcgatcgagaacgacaaggtcgaactgcgcgatgccgcccatctgtggggcaagacc
gtgtgggaaaccgaaggccagatcaagtcggaacatcaggacccgcagatccgcgtgtcg
tgcatcggccgcaccggcgagaacggcgtgctgtacgccgccatcgtcaatgacctgcac
cgcgccgccggacgttccggtgtcggtgccgtcgccggctcgaagaacctgaaggcgatc
gcggtacgcggtacgctcggcgtcggcaatatcgccaacccgaaggaattcatgaaggtc
accttcgagaagaagaagatcctcaaggagaacgcggtcaccggtcagggtctgccgacc
tacggcacgcaggtgctgatgaacgtgatcaacgaaatcggcgcgatgccgacgcgcaac
cacaaggatgtgcagttcgaaggcgcccgcaagatttcggccgaagcgatgcacgagccg
cgcgaaagcgacggcaaggcgcaactggtgaacaatcaggcctgtttcggctgcaccatc
gcctgcggtcgcatctcgaagatcgatgccacgcattacaccgtggtcaacagcccgaag
tactggggtgcatccggcggtctggaatacgaagccgcctgggcactcggctgtgccaac
ggcgtcgatgacctcgatgcgctgcagtacgcgaccatgctgtgcaacgaagacggcttc
gacccgatctcgttcggcgccaccatcggtgcagtgatggagctgtacgaaatgggcgtg
ctgacgaaggaagaaatcgggatcgaagcgcctttcggctcaggcaaggcattgacctat
ctgaccgaaatcactgcgcgtggcgaaggcttcggcaagatcatcggtctcggctcgaag
cgcctgtgcgagaagtacggtcatccggaactgtcgatgtcggtcaagggccaggagttt
ccggcctacgacgcgcgcgcggtgcagggcatgggcctgacctacgcgacctcgaaccgc
ggtgcctgccacctgcgttcgtacacgatttcgtccgaagtgctgggcattccggtcaag
accgacccgctgacgaccgaaggcaagccggcgctggtcaaggctttccaggacgccacc
gcggtggtcgattcgaccggtctgtgcgtgttcacgacctttgcgtgggcgttgtcggac
atccagccgcagttgcaggcggcgtgcgagggcgactggtcgatggaaaagctggacctg
atgggcgagcgcatctggaatatggagcgtcagttcaacaacgcggccggtttcacgcgc
aaggacgacgatctgccggcccgtctgaagacggaagcggccaaggtcggtccggccaag
ggcctggtgtcgggcatcgacaagatgattcccgagtactacgacctgcgcggctgggac
acggaaggtcgtccgaccgcggaaacagtcgcccgcctgggtctgtga

DBGET integrated database retrieval system