KEGG   Methyloversatilis sp. RAC08: BSY238_825Help
Entry
BSY238_825        CDS       T04449                                 

Definition
(GenBank) hypothetical protein
  KO
K02483  two-component system, OmpR family, response regulator
Organism
metr  Methyloversatilis sp. RAC08
Brite
KEGG Orthology (KO) [BR:metr00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:metr02022]
    BSY238_825
Two-component system [BR:metr02022]
 OmpR family
  Unclassified
   BSY238_825
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C
Motif
Other DBs
NCBI-ProteinID: AOF82815
UniProt: A0A1B3LPP5
LinkDB All DBs
Position
905155..905880
Genome map
AA seq 241 aa AA seqDB search
MNTAHPKPRLLVVDDDPDLRELLRDYLGKQDMDVRTVADGPGLRAALAHEPCDLLILDVM
LPGDDGLALCREIRAKSRLPILMLTARGDELDRIIGLEMGADDYLPKPFHPRELLARVRS
ILRRAPEHPDGDGNVRTLKFAGWTLDLGARHLVDAQGVVTPLSSGEFRMLNALAESPNRV
LSRDQLMDVLAGRSAGPFDRTVDVMISRLRRRLGDDGREPRIIRTLRSEGYVLSVPVEKH
V
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgaataccgctcaccccaagccgcgccttctggtcgtcgatgacgaccccgacctgcgc
gagctgctacgcgactatcttggcaagcaggacatggacgtgcgcaccgtggccgatggc
cccggcctgcgtgccgcgctggcgcacgagccgtgcgacctgctgattctcgacgtgatg
ctgcccggcgatgacggcctcgcgctgtgccgcgaaatccgcgcgaaatcgcgcttgccg
atcctgatgctgaccgcgcgtggcgacgaactcgaccgcatcatcggcctcgaaatgggt
gccgacgactacctgccgaaaccgtttcatccgcgcgaactgctggcccgggtgcgcagc
atcctgcgccgtgcgccagaacacccggacggtgacggcaacgtacgcacgttgaaattc
gccggctggacgctcgatctgggcgcacgccacctggtggacgcgcagggcgtcgtgacg
ccgctgtcgagtggcgaattccgcatgctcaacgcattggccgaaagccccaaccgcgtg
ctgtcgcgcgaccagctgatggacgtgctggccgggcgcagcgccgggccgttcgatcgc
acggtcgacgtgatgatcagccggctgcgccgccggctcggcgacgacgggcgcgaaccg
cgcatcatccgcacgctgcgcagcgaaggctatgtgctgtcggtgccggtggagaagcac
gtttga

DBGET integrated database retrieval system