KEGG   Methylobacterium sp. 17SD2-17: DK389_04395Help
Entry
DK389_04395       CDS       T05724                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
mets  Methylobacterium sp. 17SD2-17
Pathway
mets00010  Glycolysis / Gluconeogenesis
mets00620  Pyruvate metabolism
mets01100  Metabolic pathways
mets01110  Biosynthesis of secondary metabolites
mets01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mets00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DK389_04395
   00620 Pyruvate metabolism
    DK389_04395
Enzymes [BR:mets01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     DK389_04395
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh OmdA
Motif
Other DBs
NCBI-ProteinID: AWN39917
UniProt: A0A2U8W1H8
LinkDB All DBs
Position
944239..945759
Genome map
AA seq 506 aa AA seqDB search
MNKPEFLGSTTKSPFSARYDNFIGGQWVAPATGRYFENTSPITGRVVCEVARSDAQDVEK
ALDAAHAAKEAWGRTSPAERARILNKIADRMEENLDLIALAETWDNGKPIRETTHADIPL
AIDHWRYFAGCVRAQEGSISEIDHDTVAYHFHEPLGVVGQIIPWNFPILMAVWKLAPALA
AGNCVVLKPAEQTPASILVVMELIGDLLPPGVINVVNGFGLEAGKPLASSPRIAKIAFTG
ETTTGRLIMQYASQNLIPVTLELGGKSPNIFFADVANEDDDFLDKALEGFTMFALNQGEV
CTCPSRALVHESIYDRFIEKAIKRVEAIKQGSPLDPTTMIGAQASGEQLEKILSYIDIGR
QEGAEVLTGGERNRQEGDLAEGFYVKPTVFKGHNKMRIFQEEIFGPVLSVATFKDDEEAL
SIANDTLYGLGAGVWTRDGTRAYRFGRAIQAGRVWTNCYHAYPAHAAFGGYKQSGIGRET
HKMMLDHYQQTKNMLVSYSPKKLGFF
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgaacaagccggaattcctgggctcgaccacgaagtcgcccttctcggcgcgatacgac
aatttcatcggtggccagtgggtcgcgcccgccaccggacgctacttcgagaacacctct
cccatcaccggccgcgtcgtctgcgaggtcgcgcgctccgacgcgcaggacgtcgagaag
gccctcgacgccgcgcacgccgccaaggaagcctggggccgcacctcgccggccgagcgc
gcccgcatcctcaacaagatcgccgaccggatggaggagaacctcgatctgatcgccctg
gccgaaacctgggacaacggcaagccgatccgagagacgacccacgccgacattccgctc
gccatcgatcattggcgctacttcgccggctgcgtccgcgcgcaggagggctcgatctcc
gagatcgaccacgacacggtggcctaccacttccacgagccactcggcgtcgtcggccag
atcatcccgtggaacttcccgatcctgatggcggtgtggaagctcgcccccgcgctcgcc
gccggcaattgcgtggtgctgaagcccgccgagcaaaccccggcctcgatcctcgtcgtg
atggaactgatcggcgacctgctgccgccgggcgtcatcaacgtcgtcaacggcttcggc
ctcgaggccggcaagccgctcgcctcctcgccccgcatcgccaagatcgccttcaccggc
gagacgacgacgggccggctgatcatgcagtacgcctcccagaatctgatcccggtgacg
ctggagctcggcggcaagtcgccgaacatcttctttgccgacgtggcgaacgaggacgac
gacttcctcgacaaggcgctcgagggcttcacgatgttcgccctcaaccagggcgaggtc
tgcacctgcccgagccgcgcgctcgtccacgaatcgatctacgatcgcttcatcgagaag
gcgatcaagcgcgtcgaggcgatcaagcagggctcgcccctcgatcccaccacgatgatc
ggcgcgcaggcgtcgggtgagcagctggagaagatcctcagctacatcgatatcggccgc
caggagggcgccgaggtgctcaccggtggcgagcgcaatcgtcaggagggcgatctcgcc
gagggcttctacgtgaagccgaccgtgttcaagggccacaacaagatgcggatcttccag
gaggagatcttcgggcccgtgctctcggtggcgaccttcaaggacgacgaggaggccctc
tccatcgccaacgacacgctctacggcctcggcgccggcgtctggacccgcgacgggacc
cgcgcctaccgcttcggccgggcgatccaggccggtcgcgtctggacgaactgctaccac
gcctacccggcccacgcggccttcggcggctacaagcagtccggcatcggccgtgagacg
cacaagatgatgctcgaccactaccagcagacgaagaacatgctggtgagctactccccg
aagaagctcggcttcttctga

DBGET integrated database retrieval system