KEGG   Methylobacterium sp. 17SD2-17: DK389_16775Help
Entry
DK389_16775       CDS       T05724                                 

Gene name
trpE
Definition
(GenBank) anthranilate synthase component I
  KO
K01657  anthranilate synthase component I [EC:4.1.3.27]
Organism
mets  Methylobacterium sp. 17SD2-17
Pathway
mets00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mets01100  Metabolic pathways
mets01110  Biosynthesis of secondary metabolites
mets01130  Biosynthesis of antibiotics
mets01230  Biosynthesis of amino acids
mets02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:mets00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    DK389_16775 (trpE)
  09110 Biosynthesis of other secondary metabolites
   00405 Phenazine biosynthesis
    DK389_16775 (trpE)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    DK389_16775 (trpE)
Enzymes [BR:mets01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.27  anthranilate synthase
     DK389_16775 (trpE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Chorismate_bind Anth_synt_I_N
Motif
Other DBs
NCBI-ProteinID: AWN41852
UniProt: A0A2U8W956
LinkDB All DBs
Position
complement(3670089..3671609)
Genome map
AA seq 506 aa AA seqDB search
MASDDPYEAFAAGYEAGRPALLNLTLVADLETPVAAFLKLRARHAGAAFLLESVEGGAVR
GRYSMIGLDPDLIWRCRDGRPEIARGPDLSAFSPDDRAPLDSLRALIGESAIGEEAGIDL
PPMAAGLFGYLGYDMVRAMEALPEPNPDPLGVPDAVLVRPRVMVVFDAVRDLITVVSPVR
PTGGISARAAYEAAQARLEQVAGALEGPLPIEARADLSNVPPPEPVSNTPPADYAGMVAR
AKEYIVAGDIFQVVLSQRFEAPFTLPAFALYRSLRRTNPAPFLCYLDFEGFQVVCSSPEI
LVRVRDGKVTIRPIAGTRRRGATPAEDKALAEELLADPKERSEHLMLLDLGRNDVGRVSR
IGSVTVTGSFFLEYYSQVMHIVSNVEGEIDPARDNLDALAAGFPAGTVSGAPKVRAMEII
DELEREKRGPYGGCIGYFGARGEMDTCIVLRTAIVKDGRMHVQAGAGIVYDSDPAAEQQE
CVNKAKALFRAAEDAVRFAAQAKRGQ
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atggcctccgacgatccctacgaggccttcgcggccggctacgaggccggccgcccggcc
ctcctcaacctgacgctggtcgccgacctcgagacgccggtcgcggccttcctgaagctc
cgggcccgtcacgcgggcgcggccttcctgctggaatccgtcgagggcggcgccgtgcgc
gggcgctactcgatgatcgggctcgatccggacctgatctggcgctgccgggacggccgg
cccgagatcgcccgcggcccggatctgtcggcattcagccccgacgaccgggcgccgctc
gacagcctgcgcgcgctcatcggcgagagcgcgatcggcgaggaggccggcatcgacctg
ccgcccatggcggcgggcctgttcggctatctcggctacgatatggtgcgcgccatggag
gctttgcccgagccgaacccggacccgctcggcgtgccggacgcggtgctggtgcgccca
cgcgtgatggtggtgttcgacgcggtgcgcgacctcatcaccgtcgtcagcccggtgcgg
cctacgggtgggatctccgcccgggcggcctacgaggcggcgcaggcacggcttgagcag
gtcgccggcgccctcgaaggtccgcttccgatcgaggcgcgcgccgatctcagcaacgtg
ccgccgcccgagcccgtctcaaacaccccgcccgcggattacgcggggatggtcgctcgg
gcgaaggagtacatcgtcgcgggcgacatcttccaggtcgtgctctcgcagcgcttcgag
gcgccgttcacgctgccggccttcgccctctaccgctcgctgcggcggaccaacccggcg
ccgttcctctgctacctcgatttcgagggtttccaggtcgtctgctcgagccccgagatc
ctggtgcgggtgcgggacggcaaggtgacgatccggccgatcgcgggcacccgccgccgc
ggcgccacgcccgccgaggacaaggcgctcgccgaggaactcctggccgacccgaaggag
cgctccgagcacctgatgctgctcgacctcggccgcaacgacgtcggacgcgtctcgcgg
atcggcagcgttaccgtgaccggctcgttcttcctcgaatattacagccaggttatgcac
atcgtctcgaatgtcgagggcgagatcgaccccgcccgcgacaacctcgacgcgctggcg
gcgggattccccgccggaacggtgtcgggcgcgccgaaggtgcgggcgatggagatcatc
gacgagctggagcgggagaagcgcggaccctacggcggctgcatcggctatttcggggcc
cgcggcgagatggatacctgcatcgtgctccgcacggcgatcgtgaaggacggtcggatg
cacgtccaggcgggagccggcatcgtctacgattccgatccggccgccgagcagcaggaa
tgcgtcaacaaggcgaaggccctgttccgtgccgccgaggacgcggtccgcttcgcggcc
caagcgaagcgcgggcagtag

DBGET integrated database retrieval system