KEGG   Methanobacterium sp. BRmetb2: CIT01_03255Help
Entry
CIT01_03255       CDS       T05692                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
mett  Methanobacterium sp. BRmetb2
Pathway
mett00250  Alanine, aspartate and glutamate metabolism
mett00410  beta-Alanine metabolism
mett00430  Taurine and hypotaurine metabolism
mett00650  Butanoate metabolism
mett01100  Metabolic pathways
mett01110  Biosynthesis of secondary metabolites
mett01120  Microbial metabolism in diverse environments
mett02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:mett00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    CIT01_03255
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CIT01_03255
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CIT01_03255
   00430 Taurine and hypotaurine metabolism
    CIT01_03255
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    CIT01_03255
Enzymes [BR:mett01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     CIT01_03255
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 GDC-P
Motif
Other DBs
NCBI-ProteinID: AXV37283
UniProt: A0A347AE86
LinkDB All DBs
Position
complement(665957..667372)
Genome map
AA seq 471 aa AA seqDB search
MLSKKVNLKKMKESDREHTTTYGTRYFSKKVPKYEMPDEGMPSKAAYHLVHDELNLDGNP
ALNLASFVTTWMEPEADKLIMESIGKNFVDNDEYPQTQKIQERVVNMLARLFNVPKNCQS
VGTGTIGSSEAIMLGLLAHKWTWKKRRQKEGKPYDKPNIVMGADVHTVWEKFARYFDVEL
KLIPLERDTYTVTVDEVAKEIDENTICVGAVLGTTFTGQMDPIKEINQLLIDIKQTKGWD
IPMHVDGASGGMVIPFTNPDMQWDFRLEQVKSINVSGHKYGLVYPGVGWLVFKDEKDLPN
ELIFEVNYLGGLMPNYSLNFSKGSSTIIAQYYNFLRLGKDGYKDIMENLMETTTYIANEL
EKSGKFEVINKHLMFPLVTFKLKNSKFSVFQLSEKLREKGWIVPAYTLPPNAEDVAVLRM
VIKENFSRDMADLLMDDMMYAYDFLEKDPKEHQESAKEDEKESRKHKHKIC
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgttatctaaaaaggttaacttaaaaaagatgaaagaatcggatagggaacacaccaca
acttatgggacccgctatttttctaagaaagtacctaagtatgaaatgccggatgaggga
atgccatcaaaagcagcataccacctggttcatgatgaactaaatctggatgggaatcct
gcattgaatctggccagttttgtcacaacctggatggaaccagaagcagataaactgata
atggaaagcattggcaaaaactttgtggacaatgatgagtatcctcagacacaaaagatt
caagaaagagtggtcaatatgttggcccgattattcaacgtccctaaaaactgtcaatca
gtgggaaccggtactattggttcatcagaagcaataatgctgggtcttttagcccataaa
tggacttggaaaaaacgaagacaaaaagaaggtaaaccctatgataaacccaatattgtt
atgggtgcagacgtacacactgtttgggagaaatttgcccgttattttgacgttgaactg
aaattaatacctttagaacgagatacttatacagtaactgttgatgaggtagccaaagaa
attgatgaaaatacaatctgtgtgggggcagttttaggaacaacctttacaggacaaatg
gatcccatcaaagagattaaccaattattaattgatatcaaacaaactaagggttgggac
ataccaatgcatgtggatggtgccagcggcggcatggtgataccctttaccaatccagac
atgcaatgggatttcagattagaacaagttaaatcaatcaatgtatctggacataaatac
ggtttagtgtaccctggtgttggatggctggtatttaaagatgagaaagacttacctaac
gaattgattttcgaagttaattatttaggtggtttaatgcccaactattccctaaatttt
tccaaaggcagtagcaccataatagcccaatattacaactttttaagactgggtaaagat
ggttataaagatataatggaaaatttgatggaaacaaccacttacattgctaatgaactg
gaaaaatccggtaaatttgaggtaatcaataaacatctaatgtttcctctggtaacattt
aaattaaagaattcaaagttcagcgttttccagctatctgagaaactccgtgaaaaagga
tggatcgtcccggcatatacgctccctcctaatgctgaagatgtggcagtccttaggatg
gtcatcaaggaaaatttcagcagggacatggcagatcttttaatggatgatatgatgtat
gcctatgattttctggaaaaagatccaaaagaacatcaagagtcagctaaggaagacgaa
aaagaatctagaaaacataaacataaaatatgctaa

DBGET integrated database retrieval system