KEGG   Methanobacterium sp. BRmetb2: CIT01_05215Help
Entry
CIT01_05215       CDS       T05692                                 

Definition
(GenBank) ABC transporter ATP-binding protein
  KO
K01990  ABC-2 type transport system ATP-binding protein
Organism
mett  Methanobacterium sp. BRmetb2
Brite
KEGG Orthology (KO) [BR:mett00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mett02000]
    CIT01_05215
Transporters [BR:mett02000]
 ABC Transporters, Prokaryotic Type
  ABC-2 type and other transporters
   ABC-2 type transporter
    CIT01_05215
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 DUF4162 AAA_15 Rad17 AAA_23 AAA AAA_29 DUF5042 AAA_30 AAA_16 AAA_27 AAA_22
Motif
Other DBs
NCBI-ProteinID: AXV37635
UniProt: A0A347AF88
LinkDB All DBs
Position
1012348..1013247
Genome map
AA seq 299 aa AA seqDB search
MIEIKSLSKHFGSIKALDNLDLKIKKGELLGLIGPNGAGKTTAIRIISCILKPDHGDVLV
DGCSIYNDPLKIKSMIGYLPEEPNLYERFKAYDLLKYFAELYGVPKDEIDPRIKELLELV
DMSKRAQHKINTFSKGLRQRIGIARALIHDPKIIIFDEPTMGLDPATSNTIRKFIGSLKG
KKTIILCTHYMDEAEALCDRVAILNQGKILDIGTPDYLKSKIHGETILNVKVENVDKIRP
ADIKNLESVENVRIIGDQVSVSLSSSEEICDIVELFENNILSVNTKEPTLEDVFIQKVK
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgatagaaattaaatctttaagtaagcattttggtagtataaaagctctggacaatctt
gatcttaaaataaaaaagggagaacttttagggttgataggacccaatggcgcaggtaaa
acaacagctattaggattatatcttgtattttaaaaccagaccatggcgatgttctggtt
gatgggtgcagtatttataatgatcctctaaaaattaaatccatgataggatacttacca
gaagaacctaatctttatgaacggttcaaagcttatgatttattaaaatattttgctgaa
ctctacggagtacctaaagacgaaatcgatcctcgaattaaggaactcctggaactggtg
gatatgagtaaaagggcccagcacaaaattaacacattttctaaaggattgaggcagaga
ataggaattgcccgggctcttattcatgaccccaaaatcataatattcgatgaacctacc
atggggctggaccccgcaacttctaacactattagaaaatttattggtagtttaaaaggg
aaaaaaaccataattctctgtacacattatatggacgaagcagaagcattatgtgaccgt
gtagccatattaaatcagggcaaaatactggatattgggactccggattatttgaaatct
aaaattcatggcgaaactattttaaatgtaaaagttgaaaatgtagataaaattcgacct
gcagatataaaaaacttagaatctgtagaaaatgtaaggattataggtgaccaagtaagt
gtatccctaagttccagcgaagaaatttgtgatatcgtagaactattcgaaaataatata
ttgtccgttaatactaaagaacctacattagaagatgtatttattcaaaaagttaaataa

DBGET integrated database retrieval system