KEGG   Methylobacterium sp. XJLW: A3862_01505Help
Entry
A3862_01505       CDS       T05508                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
metx  Methylobacterium sp. XJLW
Pathway
metx00010  Glycolysis / Gluconeogenesis
metx00620  Pyruvate metabolism
metx01100  Metabolic pathways
metx01110  Biosynthesis of secondary metabolites
metx01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:metx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    A3862_01505
   00620 Pyruvate metabolism
    A3862_01505
Enzymes [BR:metx01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     A3862_01505
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh YCII
Motif
Other DBs
NCBI-ProteinID: AWV14338
UniProt: A0A2U9TW62
LinkDB All DBs
Position
complement(349804..351327)
Genome map
AA seq 507 aa AA seqDB search
MNKPEFLGDAKVKSPFSARYENFIGGQWVAPAAGRYFENTSPITGKVVCEVARSDAQDVE
KALDAAHAAKEAWGRTAPAERARILLKMADRMEENLDLLALAETWDNGKPIRETTHADIP
LAIDHFRYFAGCVRAQEGSISEIDHDTVAYHFHEPLGVVGQIIPWNFPILMAVWKLAPAL
AAGNCVVLKPAEQTPASVLVLAEIIGDLLPPGVLNIVNGFGLEAGKPLASSPRIAKIAFT
GETTTGRLIMQYASQNLIPVTLELGGKSPNIFFADVANEDDDFFDKALEGFTMFALNQGE
VCTCPSRALVHESIYDRFMERAVKRVEAITQGSPLDPATMIGAQASGEQMEKILSYIDIG
KQEGAQLLTGGERNVKEGEFAEGFYVKPTVFRGHNKMRIFQEEIFGPVLSVTTFKDDAEA
LAIANDTLYGLGAGVWTRDGTRAYRFGRAIQAGRVWTNCYHAYPAHAAFGGYKQSGIGRE
THKMMLDHYQQTKNMLVSYSAKKLGFF
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgaacaagccggaattcctcggcgacgccaaggtcaagtcgccgttctcggcccgctac
gagaacttcatcggcggccagtgggtcgcccccgcggccggccgctacttcgagaacacc
tccccgatcaccggaaaggtggtgtgcgaggtggcccgctccgacgcacaggacgtcgag
aaggcgctcgacgccgcccacgccgccaaggaggcctggggccgcacggcgccggccgag
cgcgcccgcatcctcctcaagatggccgaccggatggaggagaacctcgatctgctcgcc
ctcgccgagacctgggacaacggcaagccgatccgcgagacgacccacgccgacatcccg
ctggccatcgaccacttccgctatttcgccggctgcgtgcgggcgcaggaaggctcgatc
tccgagatcgaccacgacacggtcgcctaccatttccacgagccgctgggcgtcgtcggc
cagatcatcccgtggaacttcccgatcctgatggcggtgtggaagctcgccccggcgctc
gccgccggcaattgcgtggtcttgaagcccgccgagcagaccccggcctctgtgctggtg
ctggccgagatcatcggcgacctgctgccgccgggcgtgctcaacatcgtcaacggcttc
ggcctggaggccggcaagccgctcgcctcctcgccgcggatcgccaagatcgccttcacg
ggtgagacgaccaccggccgcctcatcatgcagtatgcgtcgcagaacctgatcccggtg
acgctggaactcggtggcaagtcgccgaacatcttcttcgccgacgtggcgaacgaggac
gacgacttcttcgacaaggcgctcgaaggcttcacgatgttcgccctcaaccagggtgag
gtctgcacctgcccgagccgcgcgctcgtgcatgagtcgatctacgaccgcttcatggag
cgggcggtgaagcgcgtcgaggcgatcacgcagggctcgcccctcgatccggccacgatg
atcggcgcccaggcgtcgggcgagcagatggagaagatcctcagctacatcgacatcggc
aagcaggagggcgcccagctgctcaccggcggcgagcgcaacgtcaaggagggcgagttc
gccgagggcttctacgtgaagccgacggtgttccgcggccacaacaagatgcggatcttc
caggaggagatcttcggcccggtcctgtcggtcacgaccttcaaggacgatgccgaggcg
ctcgcgatcgccaacgacacgctctacggcctcggcgccggcgtctggacccgcgacggc
acccgcgcctatcgcttcggccgggcgatccaggccggccgcgtctggacgaactgctac
cacgcctacccggctcacgcggccttcggcggctacaagcagtccggcatcggccgtgag
acccacaagatgatgctcgatcactaccagcagaccaagaacatgctggtcagctactcg
gccaagaagctcggattcttctga

DBGET integrated database retrieval system