KEGG   Methylobacterium sp. XJLM: A3862_13635Help
Entry
A3862_13635       CDS       T05508                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
metx  Methylobacterium sp. XJLM
Pathway
metx00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:metx00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    A3862_13635
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:metx02000]
    A3862_13635
Enzymes [BR:metx01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     A3862_13635
Transporters [BR:metx02000]
 Other Transporters
  Pores ion channels [TC:1]
   A3862_13635
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N GST_C_2 GST_N_2 GST_C GST_C_3
Motif
Other DBs
NCBI-ProteinID: AWV16416
UniProt: A0A2U9TYM3
LinkDB All DBs
Position
3003247..3003882
Genome map
AA seq 211 aa AA seqDB search
MPDIEFFHSPNTRSSGVRVLLEELGVPYRLHVLNMRAGEHLEGAYRAVNPMAKVPAIRHG
EAVVTEQAAVYLYLADLFPEAGLAPAPTEPDRGTYLRWMVFYGSCFEPAVIDRHLKREPG
PRAMSAYADYDSVIARVKEALTPGPYLLGERFSAADILWGGALGWTTGFGLVEPAPVLTA
YVERIRSRPAARMVAAEDAQLAEAHQAAASA
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgcctgacatcgagttctttcattcgcccaatacccgctcgtcgggggtgcgcgtcctg
ctcgaggaactcggtgtcccgtaccggctgcacgtgctcaacatgcgcgccggcgagcac
ctcgaaggggcctaccgtgccgtcaatccgatggcgaaggtgccggcgatccgccacggc
gaggccgtggtgaccgagcaggcggccgtctacctctacctcgccgacctgttccccgag
gccgggctcgccccggcgcccaccgagcccgaccggggcacctatctgcgctggatggtg
ttctacggctcctgcttcgagcccgcggtgatcgatcggcacctgaagcgggagccgggc
ccacgcgccatgtcggcctatgccgattacgacagcgtgatcgcccgggtgaaggaggcg
ctgacgccggggccgtacctgctcggcgagcgcttcagcgccgccgacatcctgtggggc
ggcgccctcggctggacgacgggcttcggcctcgtggagcccgcgcccgtcctgacggcc
tatgtcgagcgcatccggtcccgtccggccgcccggatggtcgcggcggaggatgcgcag
ctcgcggaggcgcatcaggcggccgcctcggcctga

DBGET integrated database retrieval system