KEGG   Methylobacterium sp. XJLW: A3862_16445Help
Entry
A3862_16445       CDS       T05508                                 

Definition
(GenBank) aminodeoxychorismate/anthranilate synthase component II
  KO
K01658  anthranilate synthase component II [EC:4.1.3.27]
Organism
metx  Methylobacterium sp. XJLW
Pathway
metx00400  Phenylalanine, tyrosine and tryptophan biosynthesis
metx00405  Phenazine biosynthesis
metx01100  Metabolic pathways
metx01110  Biosynthesis of secondary metabolites
metx01130  Biosynthesis of antibiotics
metx01230  Biosynthesis of amino acids
metx02024  Quorum sensing
Module
metx_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:metx00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    A3862_16445
  09110 Biosynthesis of other secondary metabolites
   00405 Phenazine biosynthesis
    A3862_16445
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    A3862_16445
Enzymes [BR:metx01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.27  anthranilate synthase
     A3862_16445
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase Peptidase_C26 SNO
Motif
Other DBs
NCBI-ProteinID: AWV19528
UniProt: A0A2U9UA50
LinkDB All DBs
Position
3602659..3603273
Genome map
AA seq 204 aa AA seqDB search
MPNVLVIDNYDSFTWNLVHLIGPLCGTVDVVRNDALTIPDIRARAPDAIVLSPGPCTPTE
AGICLDVVRDLSEEIPIFGVCLGLQAIGQAFGGDVVRAPLPLHGKVSTIRHGARGLFRGL
NDSFEATRYHSLVVDRATCPAALRVTAEADGLIMGLEHAERPLHGVQFHPESIRSQHGTE
IVKNFLDLATAWNTARDRTRADVH
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgcccaacgtcctcgtcatcgacaactacgattccttcacctggaatctcgtgcacctg
atcggtccgctctgcgggaccgtcgatgtcgtgcgcaacgacgcgctcacgatccccgac
atccgcgccagggcgccggacgcgatcgtgctgtcgcccgggccatgcacgcccacggag
gcgggtatctgcctcgacgtggtccgtgatctgtccgaggagatcccgattttcggcgtg
tgcctgggtctccaggccatcggacaagcgttcggcggcgatgtcgtgcgggcgcccctg
ccgctccacggcaaggtatcgacgatccggcacggagcccgcggcctgttccgcggcctg
aacgacagcttcgaggcgacccgctaccactccctcgtggtcgatcgtgcgacctgcccg
gccgcgttgcgggtcaccgcggaggcggacggcctgatcatggggctcgagcatgccgag
cgtccgctccatggcgtccagttccatcccgagagcatccggtcgcagcacggcacggag
atcgtgaagaacttcctcgatcttgccacggcctggaatacggcgcgtgacaggacgcgt
gccgacgtgcattga

DBGET integrated database retrieval system