KEGG   Methylobacterium sp. XJLW: A3862_20750Help
Entry
A3862_20750       CDS       T05508                                 

Definition
(GenBank) proline--tRNA ligase
  KO
K01881  prolyl-tRNA synthetase [EC:6.1.1.15]
Organism
metx  Methylobacterium sp. XJLW
Pathway
metx00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:metx00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    A3862_20750
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:metx01007]
    A3862_20750
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:metx03016]
    A3862_20750
Enzymes [BR:metx01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.15  proline---tRNA ligase
     A3862_20750
Amino acid related enzymes [BR:metx01007]
 Aminoacyl-tRNA synthetase
  Class II (C/G)
   A3862_20750
Transfer RNA biogenesis [BR:metx03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    A3862_20750
 Prokaryotic type
    A3862_20750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_2b HGTP_anticodon
Motif
Other DBs
NCBI-ProteinID: AWV17630
UniProt: A0A2U9TXD8
LinkDB All DBs
Position
4556094..4557419
Genome map
AA seq 441 aa AA seqDB search
MRLSRYFMPTLRETPKEAEIVSHRLMLRAGLVRQESAGIYAWLPLGLRVLERVCAVIRRE
QDRSGAIEILMPTVQSAELWRESGRYDAYGKEMLRLKDRHEREMLYGPTAEEMVTEIFRA
SVRSYKDLPKNLYQISWKFRDEVRPRFGTMRSREFLMKDAYSFDFDQAGARHAYNRMFVA
YLRTFAGLGLKAIPMRADTGPIGGDLSHEFIILAKTGESEVFCDKAYLDFDIPPETVDFD
DVAALQGIVDAWTSHYAATEEMHEPEAFAEVAEDSRLAARGIEVGHIFYFGTKYSEPMGA
KVAGPDGIERPVHMGSYGIGPSRLVAAIIEASHDEAGIIWPDSVAPFDVALINLKVGDAG
TDAACAQIQSDLETAGLSVLYDDRDERPGAKFATADLIGLPWQVIVGPKGLAEGKVELKR
RAGGERESLAIVDLLARIRRV
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgcgtctctcccgctatttcatgccgaccttgcgcgagacgcccaaggaagccgagatc
gtctcgcatcggctgatgctgcgcgccggcctggtgcgtcaggagtcggccggcatctac
gcgtggctgccgctcggcctgcgggtgctggagcgggtctgcgcggtgatccggcgggag
caggaccgttccggcgccatcgagatcctgatgccgacggtgcaatccgccgagctgtgg
cgggaatccggccgctacgacgcctacggcaaggagatgctgcgcctgaaggaccggcac
gagcgcgagatgctctacggccccaccgccgaggagatggtcaccgagatcttccgggcg
agcgtgcgctcctacaaggacctgcccaagaacctctaccagatctcgtggaagttccgc
gacgaggtgcggccgcgcttcggcacgatgcgctcccgcgagttcctgatgaaggacgcc
tactcgttcgatttcgaccaggccggcgcccgccacgcctacaaccggatgttcgtcgcc
tacctgcgcaccttcgccgggctcggcctcaaggcgatcccgatgcgcgccgataccggc
cccatcggcggcgacctgtcccacgagttcatcatcctggccaagaccggcgagagcgag
gtcttctgcgacaaggcctatctcgacttcgacatcccgccggagaccgtggatttcgac
gacgtcgccgccctccagggcatcgtcgatgcctggacctcgcactacgcggccaccgag
gagatgcacgagccggaggcctttgcggaggttgcggaggacagccgcctcgcggcacgc
ggcatcgaggtcgggcacatcttctatttcggcaccaagtattccgagccgatgggcgcc
aaggtcgccgggccggacgggatcgagcggccggtccatatgggctcctacggcatcggt
ccgagccggctggtagcggcgatcatcgaggcgagccacgacgaggccggcatcatctgg
ccggactcggtcgcgccgttcgacgtggccctgatcaatctgaaggtcggcgatgccggc
accgatgccgcctgcgcgcagatccagtcggatctcgagaccgccggcctgtcggtgctc
tacgacgaccgcgacgagcgccccggcgccaagtttgccaccgcggacctgatcggcctg
ccctggcaggtgatcgtcgggccgaagggcttggcggagggcaaggtcgagctgaagcgg
cgtgccgggggcgagcgcgagagcctcgccatcgtcgatctgctggcacgcatccggcgc
gtctga

DBGET integrated database retrieval system