KEGG   Metakosakonia sp. MRY16-398: MRY16398_02350Help
Entry
MRY16398_02350    CDS       T05735                                 

Definition
(GenBank) cellulose synthase catalytic subunit
  KO
K00694  cellulose synthase (UDP-forming) [EC:2.4.1.12]
Organism
mety  Metakosakonia sp. MRY16-398
Pathway
mety00500  Starch and sucrose metabolism
mety01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mety00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    MRY16398_02350
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:mety01003]
    MRY16398_02350
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mety02000]
    MRY16398_02350
Enzymes [BR:mety01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.12  cellulose synthase (UDP-forming)
     MRY16398_02350
Glycosyltransferases [BR:mety01003]
 Polysaccharide
  Structural polysaccharide
   MRY16398_02350
Transporters [BR:mety02000]
 Other Transporters
  Others
   MRY16398_02350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_2 Glyco_tranf_2_3 Cellulose_synt Glyco_trans_2_3 Glyco_transf_21 PilZ DUF2700
Motif
Other DBs
NCBI-ProteinID: BBE75179
UniProt: A0A348D6R2
LinkDB All DBs
Position
253399..255996
Genome map
AA seq 865 aa AA seqDB search
MSRLAALFLTPPVYARLSERYRFYRRNKASGFSAACGCFWVALAWLFLPLENDRWQRVRE
QHQALFPHINPDKPRPLDPARYLLQVLWLLATLPQHVAAQAQKPERVHKLRERYHRWLDS
LPTRVSDQTRHLDNQKELGHLSRRTRRFILGIIITFSLILAIVCITQPFNPLSQLIFLLL
LWGVALLVRRIPGRFSALMLIVLSLTVSCRYIWWRYTSTLNWDDPVSLVCGIVLLFAETY
AWIVLILGYFQVAWPLNRQPVPLPKDMALWPSVDIFVPTYNEDLNVVKNTIYAAMGIDWP
KDKLKIWILDDGGREEFRQFAQTVGVEYIARTTHEHAKAGNINNALKYAKGDFVSIFDCD
HVPTRSFLQMTMGWFIKEKDLAMMQTPHHFFSPDPFERNLGRFRKTPNEGTLFYGLVQDG
NDMWDATFFCGSCAVIRRGPLDEIGGIAVETVTEDAHTSLRLHRRGHTSAYMRIPQAAGL
ATESLSAHIGQRIRWARGMIQIFRLDNPLLGKGLKLAQRLCYVNAMLHFLSGIPRLVFLT
APLAFLLLHAYIIYAPAIMIALFVLPHMIHASLTNSKIQGKYRHSFWSEIYETVLAWYIA
PPTLVALFNPHKGKFNVTAKGGLVEEEYVDWVISRPYIFLVLLNIVGVLVGIWRYFYGPQ
NEILTVFVSIAWVFYNLIILGGAVAVSVESKQVRRAHRVEIAMPAAIAREDGHLFSCTVH
DFSDGGLGIKINGQAQVLEGQKVSLLLKRGQQEYVFPTMVVRVSGNEVGLQLMPLTTKQH
IDFVQCTFARADTWALWQDSFPEDKPLESLMDILKLGFRGYRHLAEFAPPSVKMIFRSLT
ILVAWIVSFIPRRPEREAVIQHPVT
NT seq 2598 nt NT seq  +upstreamnt  +downstreamnt
atgagtcgtctggccgccttgtttctgacccccccggtatatgcccgcttaagcgagcgt
taccgcttttatcgccggaataaggcgtcggggttcagtgcggcatgcggctgtttctgg
gtagcactggcatggctgtttctgccgctggaaaatgatcgctggcagcgggtgcgtgag
cagcatcaggcgctgtttccacacattaatccggacaaaccgcgtccgcttgacccggca
cgttatctgttgcaggtcctctggctgctggcaactttgccacagcatgtggcagcgcag
gcgcagaaacctgaacgcgtccataagctgcgcgaacgttaccatcgctggctggattct
ctgcccacccgcgtttctgaccagacccgccacctggataaccaaaaagaactggggcat
ctcagccggcgaacgcgacgtttcattctggggatcatcatcaccttctcgctgattctg
gcgatcgtctgcattacccagccgtttaacccactgtcgcagctcattttcctgctgctg
ttatggggcgtggccctgttggttcgtcgtattccggggcgtttctccgcgctgatgctg
atcgtcctgtcgctaacggtctcctgccgctacatctggtggcgctatacctccaccctg
aactgggatgacccggtcagcctggtgtgcggtatcgtgttgctgttcgccgaaacctat
gcgtggattgtgctcattctcggctatttccaggtggcctggccgcttaatcgtcagccg
gtgccgctgccaaaagatatggctctctggccgtcggtcgatatttttgtgcccacctat
aacgaagatttaaatgtggtgaaaaacaccatttatgcggcgatgggtatcgactggccg
aaagataaactcaaaatctggatccttgatgacggcggtcgggaagagtttcgtcagttt
gcccagaccgtgggtgtggaatacatcgcccgtaccacccatgagcacgcgaaagccggg
aacatcaataatgcgctgaaatatgccaaaggcgatttcgtttcgatttttgactgcgac
cacgtgccgacgcgctctttcctgcaaatgaccatgggctggtttatcaaagaaaaagat
ctggcgatgatgcagacgccgcaccactttttctcgccggacccgttcgagcgcaacctt
ggccgtttccgtaaaacgccaaacgaaggaactctgttctacgggctggttcaggacggc
aacgatatgtgggatgccaccttcttctgcggctcgtgtgcggtcattcgtcgtggtccg
ctggatgagattggcggtatcgcggtggaaacggtcaccgaagatgcccatacctcgctg
cgcctgcatcgcagaggacatacttctgcctatatgcgtattcctcaggccgccggtctg
gcaacggagagtctgtcggcgcacatcggccagcgtatccgctgggcgcgcgggatgatt
cagattttccgtctcgataatcccctgctcggcaaagggctgaaactggcgcagcgtctg
tgttacgtcaacgccatgctgcacttcctctccgggatcccgcgcctggtgtttctcacc
gcgccgctggcgttcctgctgctgcatgcctacatcatctatgcgccagccatcatgatt
gcgctgtttgttttgccgcacatgatccacgccagcctgaccaactccaaaattcagggt
aaatatcgccattcgttctggagtgaaatctacgaaacggtactggcctggtatatcgca
ccgccgactctggtggcgctctttaacccgcacaagggcaaattcaacgtcaccgcaaaa
gggggactggtcgaagaagagtatgtcgactgggttatctcccggccctatatcttcctt
gttttgctgaacatcgtcggcgtgctggtgggcatctggcgttatttctacggcccgcaa
aacgagattttaacggtcttcgtcagtatcgcatgggtgttctacaacctgattatcctc
ggtggcgcggtggcggtatcggtggaaagcaagcaggttcgtcgcgcgcaccgcgtggag
atcgccatgcctgcggctatcgcccgcgaagacggtcatctgttctcctgtaccgtgcat
gatttttccgacggcggcctggggatcaaaatcaacggccaggcccaggtactggaaggg
cagaaagtcagcctgctgttaaaacgcggccaacaagagtatgtcttcccgacaatggtc
gtgcgcgtttccggcaatgaggtggggctgcaattaatgccgctgaccacgaaacagcat
atcgattttgtgcagtgtacgtttgcccgtgcggatacatgggcgttgtggcaggacagc
ttcccggaagataagccactggaaagcttaatggatattttaaaactgggcttccgtggt
tatcgccatctcgcggaatttgctccaccgtctgtgaaaatgattttccggtcgctaacc
atactggttgcctggattgtgtcgtttataccgcgtcgcccggaacgtgaagcggtaata
cagcaccccgtgacgtga

DBGET integrated database retrieval system