KEGG   Metakosakonia sp. MRY16-398: MRY16398_03430Help
Entry
MRY16398_03430    CDS       T05735                                 

Definition
(GenBank) aspartate aminotransferase family protein
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
mety  Metakosakonia sp. MRY16-398
Pathway
mety00250  Alanine, aspartate and glutamate metabolism
mety00410  beta-Alanine metabolism
mety00640  Propanoate metabolism
mety00650  Butanoate metabolism
mety01100  Metabolic pathways
mety01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mety00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    MRY16398_03430
   00650 Butanoate metabolism
    MRY16398_03430
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    MRY16398_03430
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MRY16398_03430
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mety01007]
    MRY16398_03430
Enzymes [BR:mety01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     MRY16398_03430
Amino acid related enzymes [BR:mety01007]
 Aminotransferase (transaminase)
  Class III
   MRY16398_03430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: BBE75287
UniProt: A0A348D720
LinkDB All DBs
Position
372325..373608
Genome map
AA seq 427 aa AA seqDB search
MTGEFKVKNNELHQRRLQATPRGIGVMCGFYAEKAENATLWDVEGNEVIDFAAGIAVLNT
GHRHPKIVAAVEKQLQAFTHTAYQIVPYESYVSLAERINERVPVEGPAKTAFFSTGAEAL
ENAVKIARAYTKRPGVITFGGGFHGRTYMTMALTGKVAPYKIGFGPFPGSIFHAQFPNAL
HGVSTEDAMKSLDRIFKADIAPDQVAAILLEPVQGEGGFNIAPDDFLQALRKLCDTHGIL
LITDEVQSGFARTGKLFAVEHYSIKPDLITMAKSLAGGLPLSAVAGRAEVMDAPAPGGLG
GTYAGNPLAVAAAHAVMDVIEEENLCERANHLGKHLVEVLTKAKADCPYIADIRAQGSMV
AVEFNDPQSGEPSAEFTKQVQDKALAAGLLLLSCGVYGNVIRFLYPLTIPEVQFRKALDI
IYQSLTH
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgacgggggagtttaaggtgaagaataacgaattacatcaacgccgtttacaggcgaca
ccgcgtggtattggcgtgatgtgcggcttctatgccgagaaagcagaaaatgccactctg
tgggatgtggaaggcaacgaagtcatcgatttcgccgccgggattgcggtgctcaatacc
ggccatcgccatcctaaaattgtcgcagcagtggaaaagcagttgcaggcctttacccac
acggcttatcagattgtcccttacgaaagctacgtctcgctggcggaacgcattaacgaa
cgcgtaccggtagaaggcccggccaaaacagcctttttctcgaccggggcggaagcgctg
gaaaacgcggtcaaaatcgcccgcgcctataccaaacgtcctggtgtgattactttcggc
ggcggtttccatggacgtacctatatgaccatggcgctgaccggcaaagtggcaccgtac
aaaatcggttttggcccgttccctggttccattttccatgcgcaattcccgaatgcgttg
cacggtgtcagtactgaagacgctatgaaaagcctggatcgtatttttaaagcggatatc
gcccccgatcaggttgcagccattttactcgagccggtacagggcgaaggcggctttaat
atcgcgccagacgactttctgcaggcgctgcgtaagttgtgcgatacccatgggattttg
ctgattaccgatgaagtgcagtccggctttgcgcgtaccggtaaactcttcgcggtggaa
cattacagcattaaacctgacttaatcaccatggcgaaaagcctggcgggcggcctgccg
ctgtcagcagtggcagggcgtgcggaggtgatggacgcacccgcgccgggggggttaggc
ggtacttatgccggtaacccgctggccgttgccgctgcgcatgccgtgatggatgtgatt
gaagaggaaaatctttgcgaacgcgcgaaccacctgggtaagcatctggttgaagtgctg
accaaagcgaaagcggactgtccgtacattgcggatattcgcgcccagggttctatggtg
gccgtggagtttaacgatccgcaaagcggtgaaccgtcggcggaattcactaagcaggtg
caggataaagcgctggccgccgggctgttgctgttgagttgcggtgtctacggtaacgtg
attcgcttcctctatccgctgactattccggaagttcagttccgtaaagcgctggatatt
atctaccagtcactgactcactaa

DBGET integrated database retrieval system