KEGG   Metakosakonia sp. MRY16-398: MRY16398_06260
Entry
MRY16398_06260    CDS       T05735                                 

Definition
(GenBank) galactitol-1-phosphate 5-dehydrogenase
  KO
K00094  galactitol-1-phosphate 5-dehydrogenase [EC:1.1.1.251]
Organism
mety  Metakosakonia sp. MRY16-398
Pathway
mety00052  Galactose metabolism
mety01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mety00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    MRY16398_06260
Enzymes [BR:mety01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.251  galactitol-1-phosphate 5-dehydrogenase
     MRY16398_06260
SSDB
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C Methyltransf_31 MTS TrkA_N UDPG_MGDP_dh_N Methyltransf_25 2-Hacid_dh_C Methyltransf_11 ADH_zinc_N_2 3HCDH_N Shikimate_DH Pyr_redox Pyr_redox_2 ThiF PrmA
Other DBs
NCBI-ProteinID: BBE75570
UniProt: A0A348D7V3
LinkDB
Position
complement(655343..656386)
AA seq 347 aa
MKSVVIHAEGNICVEERPEPQLKHDDDVKVRVVSSGLCGSDIPRIFAKGAHFYPITLGHE
FSGYIQEMGKSVTDLATGDAVACVPLLPCFDCPECRKQYFSLCKRYQFVGSRSDGGNAEY
VVVRRANLIRLPEEMAIEDGAFIEPITVGLHAFHLAGGCADKNVVIVGAGTIGLLAMQCA
LALGAKSVTAIDINPDKLALAKSLGATHAFNSRELSAAQILENLTDNRFDQLILETAGAP
QTVSLAIEIAGPRAQLALVGTLHNDLTLTATVFGQILRKELTILGSWMNYSGPWPGEEWV
TATRLLTEKRLTLEPLIAHRGGPESYAQAVQALNGAPMQGKILLKLD
NT seq 1044 nt   +upstreamnt  +downstreamnt
atgaaatcagtggttattcacgctgaggggaacatctgcgttgaagaacgtcctgaacct
cagttaaagcatgacgatgacgtcaaagtcagagtagtcagttccgggttatgcggttct
gatatcccgcggattttcgcaaaaggagcccatttttaccctattaccctggggcatgaa
ttcagcggctatatccaagaaatggggaaaagcgttaccgacctcgcaacgggcgacgcg
gtagcctgcgtgccactccttccctgctttgactgcccggaatgccgcaagcagtacttt
tctttgtgcaaacgctaccagtttgtcgggtcacggagcgacggcggcaatgcggagtac
gttgtggtcagacgggcaaatctgattcgtctgccagaagaaatggccattgaggatggc
gcttttatcgaacctatcaccgtcggtctgcacgcgtttcatctggcgggcgggtgtgcc
gataaaaacgtggtaattgtcggtgccgggacgattggtctgctggccatgcagtgcgca
ctggcgctgggggcgaaaagcgtaacggcaattgacatcaacccggacaaattagcgctg
gcaaaaagcctcggggcgacgcacgcctttaatagccgcgaactgagcgccgcgcaaatt
ctcgaaaatctgaccgacaaccgctttgaccagcttattctggagaccgcaggcgctcca
caaaccgtttcactggccattgagattgccggtccacgtgcccaactggcactggtcggc
acgctgcataatgacctgacgctgaccgcaaccgtcttcggacaaattctgcgtaaggag
ctaacaattctggggagttggatgaactactcaggcccgtggccgggggaagagtgggtg
accgccacccgcctgctcacggaaaaacgccttacactggaaccccttattgcccatcga
ggtggaccagagagctatgcccaggccgttcaggcattaaacggcgcgccaatgcaggga
aaaatcctactgaagctggattaa

DBGET integrated database retrieval system