KEGG   Metakosakonia sp. MRY16-398: MRY16398_14550Help
Entry
MRY16398_14550    CDS       T05735                                 

Definition
(GenBank) malic enzyme
  KO
K00029  malate dehydrogenase (oxaloacetate-decarboxylating)(NADP+) [EC:1.1.1.40]
Organism
mety  Metakosakonia sp. MRY16-398
Pathway
mety00620  Pyruvate metabolism
mety01100  Metabolic pathways
mety01120  Microbial metabolism in diverse environments
mety01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mety00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    MRY16398_14550
Enzymes [BR:mety01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.40  malate dehydrogenase (oxaloacetate-decarboxylating) (NADP+)
     MRY16398_14550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTA_PTB malic Malic_M ELFV_dehydrog Oxidored_nitro
Motif
Other DBs
NCBI-ProteinID: BBE76399
UniProt: A0A348DA82
LinkDB All DBs
Position
1520569..1522848
Genome map
AA seq 759 aa AA seqDB search
MDDQLKQSALDFHEFPHPGKIQVSPTKPLATQRDLALAYSPGVAAPCLEIEKDPLAAYKY
TARGNLVAVVSNGTAVLGLGNIGALAGKPVMEGKGVLFKKFAGIDVFDIEVDEHDPDKLI
DVVAALEPTFGGINLEDIKAPECFYIEAKLRERMNIPVFHDDQHGTAIISTAAILNGLRV
VEKNLSDVRMVVSGAGAAAIACMNLLVALGMQKHNIVVCDSKGVIYKGREANMAETKAAY
AVEDDGKRTLADVVDGADIFLGCSGPKVLTPEMVKKMARQPLILALANPEPEILPPLAKE
VRPDAIICTGRSDYPNQVNNVLCFPFIFRGALDVGATAINEEMKLAAVHAIAELAHAEQS
EVVASAYGDQDLSFGPDYLIPKPFDPRLIVKIAPAVAKAAMDSGVATRPIADFDAYVDKL
TEFVYKTNLFMKPIFSQARKEPKRVVLTEGEEPRVLHATQELITLGLAKPILVGRPGVIE
MRIQKLGLQIRPNVDFEIVNNESDPRFKEYWTEYYSIMKRRGISQEQAQRAVISDTTVIG
AIMVHRGEADAMICGTIGDYHEHFSVVQEIFGYREGVHAAGAMNALLLPSGNTFIADTYV
NENPSAEQLAEITLLAAETVRRFGIEPRVALLSHSQFGSSKSLAALKMRETLELVRERAP
ELMIDGEMHGDAALVESIRHERMPDSPLKGSANILIMPNVEAARISYNLLRVSSSEGVTV
GPVLMGVSKPVHVLTPIASVRRIVNMVALAVVEAQTQPL
NT seq 2280 nt NT seq  +upstreamnt  +downstreamnt
atggacgaccaactcaaacaaagtgccctcgatttccacgagttcccgcatcctgggaaa
attcaggtgtctccaacgaagcccctggccacacagcgcgatctggcgctggcttactcg
ccgggtgttgcggctccgtgtcttgaaatcgagaaagatccgctggcagcttacaagtat
acggcgcgtggcaacctggttgccgtcgtctcaaacggtaccgccgtgcttggactgggt
aacattggcgccctcgccgggaagccggtgatggaaggcaagggcgttctgtttaagaaa
ttcgccggcattgatgtatttgatatcgaagtcgacgagcatgatccggacaagctgatc
gatgtggtggcggcgctggagccgaccttcggtggcatcaacctggaagatatcaaagcg
ccagagtgcttctatattgaggcaaaactgcgcgaacgcatgaacattcccgtttttcac
gatgaccagcacgggacggccatcatcagtaccgcagccattctgaacggcctgcgcgtg
gtagagaaaaatctgtctgacgtgcgtatggtggtctccggagcaggggcggcggcaatc
gcctgtatgaacctgctggtggcgctgggcatgcagaaacacaacattgtggtatgcgac
tccaaaggggttatctacaaaggccgtgaagcgaacatggcggaaaccaaagcggcttat
gccgtggaggatgacggcaaacgcacgctggcagatgtggttgacggcgcggatattttc
ctcggctgttccggtccgaaagtgctgacgccggagatggtcaaaaaaatggcgcgtcag
ccgctgattctggcgctggcaaacccggaaccggaaattctgccgccgctggcgaaagag
gttcgcccggatgcgatcatctgtactggccgttccgattaccctaaccaggtcaacaac
gtactctgcttcccgtttatcttccgtggtgcgctggatgtgggtgcgacggcgattaac
gaagagatgaagctggcggcggtacatgcgattgccgagctggcgcatgccgagcagagt
gaggtggtggcctccgcctatggcgatcaggatctgagctttggcccggattatctgatc
ccgaaaccgttcgatccgcgtttgattgtgaagatcgcccccgcggtggcaaaagcggcg
atggattccggcgtcgcaacccgtccgatcgctgattttgacgcctatgtcgataagctc
accgagtttgtctacaaaacaaacctgtttatgaagcctatcttctcgcaggcacgtaaa
gagccaaaacgcgttgtgttgaccgaaggggaagagccgcgcgtgctgcatgcgacgcag
gagctgatcactctggggctggcgaagccgattctggtgggccgtccgggcgtgatcgaa
atgcgtatccaaaaactggggctgcaaattcgacccaacgttgactttgagatcgtcaac
aatgaatcggatcctcgcttcaaagagtactggaccgagtattacagcatcatgaaacgg
cgcggtatctctcaggaacaggcgcagcgtgcggtgatcagcgataccacggtgattggc
gcgatcatggttcaccgcggtgaagcggatgcaatgatctgcggcaccatcggtgattat
catgaacactttagcgttgtgcaggagatcttcggctatcgcgaaggcgtgcatgcggcc
ggggcgatgaacgcgttgttgctgcccagcgggaacacctttatcgccgatacctatgtg
aatgagaaccccagcgctgaacaactggcggagattaccttgctggcggcagaaactgtg
cgccgttttggtatcgagccgagagtggcgctgttatcccattcgcagtttggttcctcg
aaatcgctggctgcgctgaaaatgcgtgaaacgctggagctggtgcgcgagcgtgcaccc
gagctgatgattgacggggagatgcacggggacgccgcgctggtggagagtatccgccat
gaacgtatgccggacagtccgctgaaaggctcggcgaatatcctgattatgccaaacgtt
gaggctgcccgtattagttacaacttactacgggtatcgagctccgagggggtgacggtg
gggccggtgctcatgggcgtatcgaaaccggtgcatgtcctgacgcctatcgcctccgta
aggcgtatcgttaacatggtggcgctggcggtggtagaggcgcagacacagccgctgtaa

DBGET integrated database retrieval system