KEGG   Metakosakonia sp. MRY16-398: MRY16398_15650Help
Entry
MRY16398_15650    CDS       T05735                                 

Gene name
fadI
Definition
(GenBank) 3-ketoacyl-CoA thiolase
  KO
K00632  acetyl-CoA acyltransferase [EC:2.3.1.16]
Organism
mety  Metakosakonia sp. MRY16-398
Pathway
mety00071  Fatty acid degradation
mety00280  Valine, leucine and isoleucine degradation
mety00281  Geraniol degradation
mety00362  Benzoate degradation
mety00592  alpha-Linolenic acid metabolism
mety01100  Metabolic pathways
mety01110  Biosynthesis of secondary metabolites
mety01120  Microbial metabolism in diverse environments
mety01130  Biosynthesis of antibiotics
mety01212  Fatty acid metabolism
Module
mety_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mety00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    MRY16398_15650 (fadI)
   00592 alpha-Linolenic acid metabolism
    MRY16398_15650 (fadI)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MRY16398_15650 (fadI)
  09109 Metabolism of terpenoids and polyketides
   00281 Geraniol degradation
    MRY16398_15650 (fadI)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MRY16398_15650 (fadI)
   00642 Ethylbenzene degradation
    MRY16398_15650 (fadI)
Enzymes [BR:mety01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.16  acetyl-CoA C-acyltransferase
     MRY16398_15650 (fadI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: BBE76509
UniProt: A0A348DAJ2
LinkDB All DBs
Position
1660126..1661436
Genome map
AA seq 436 aa AA seqDB search
MSQALPLVTRQGDRIAIVSGLRTPFARQATVFHGVPAIDLGKMVVGELLARSEIPPEIIE
QLVFGQVVQMPEAPNIAREIVLGTGMSVHTDAYSVSRACATSFQAVANVAESLMAGTIRA
GIAGGADSSSVLPIGVSKKLARVLVDANKARSTGQKLKLFSRLRLRDLLPVPPAVAEYST
GLRMGDTAEQMAKTYGITRQEQDALAHRSHQFAAQAWAEGKLADEVMTAYAPPFRDPITQ
DNNVRQNSSLADYAKLRPAFDRRHGTVTAANSTPLTDGAAAVILMTESRAKELGLQPLGY
LRSYAFTAIDVQQDMLLGPAWATPLALDRAGLTMADLTLLDMHEAFASQTLTNLKLMASE
RFARDVLGRSQATGEVDDSKFNVLGGSIAYGHPFAATGARMITQTLHELRRRGGGFGLVT
ACAAGGLGAAMVLEAE
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaggcattaccgcttgtcacccgtcagggcgaccgcatcgccattgtcagtgga
ttacgtacgccatttgcccgtcaggcaacggtattccacggtgtcccggctatcgatctc
ggcaaaatggtggtgggcgaactccttgcccgtagcgaaatcccgccggaaatcattgaa
caactggtctttggccaggtggtgcaaatgccggaagcgccgaatatcgcgcgagaaatc
gtgctgggaacgggcatgagtgtgcacaccgatgcctacagcgtcagccgcgcctgtgcc
accagttttcaggcggtggcaaacgttgccgaaagcctgatggcggggacgatccgtgca
ggtatcgcgggtggtgctgactcctcatcagtgttgcccatcggcgtgagcaaaaaactg
gctcgcgtgctggttgatgccaacaaagcgcgcagcacagggcaaaaattaaagcttttc
tcccgtttacggctgcgtgatttactgccggtgccgcctgcggtagctgaatattctact
ggtttacgcatgggcgataccgcagagcagatggcgaaaacctatggcatcacgcgtcaa
gaacaggatgcgctggcccaccgttctcaccagtttgcggcgcaggcctgggctgaagga
aagctggcggatgaagtgatgaccgcctatgcgccaccttttcgcgatccgataacccag
gacaataatgtacggcaaaattccagcctcgcggattacgccaaactgcgtccggccttt
gatcgtcgacacggcaccgtgaccgcggcgaacagtactccccttaccgatggcgcggca
gcggtgatcctgatgaccgaatcgcgggcgaaagagctgggtttgcagcctctgggatac
ctgcgaagctatgctttcaccgccattgacgtgcagcaggacatgctgctgggacccgcc
tgggcgacgccgctggcgctcgacagagcagggctgacgatggcggatttaaccttactg
gatatgcacgaagcctttgcgtcgcaaaccctgaccaacctgaaactgatggccagcgag
cgttttgcccgcgatgtattgggccggtcgcaggcaacgggtgaggtggatgacagcaaa
ttcaacgtgctggggggatcaattgcttacgggcatccgtttgcggcaaccggtgcgcga
atgatcacccaaaccttgcatgaactgcgcagacgcggcggcggatttggccttgtcacc
gcctgtgccgcaggcgggcttggcgcagctatggttctggaggccgaataa

DBGET integrated database retrieval system