KEGG   Metakosakonia sp. MRY16-398: MRY16398_15660Help
Entry
MRY16398_15660    CDS       T05735                                 

Gene name
fadJ
Definition
(GenBank) fatty acid oxidation complex subunit alpha
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
mety  Metakosakonia sp. MRY16-398
Pathway
mety00071  Fatty acid degradation
mety00280  Valine, leucine and isoleucine degradation
mety00281  Geraniol degradation
mety00310  Lysine degradation
mety00362  Benzoate degradation
mety00380  Tryptophan metabolism
mety00410  beta-Alanine metabolism
mety00640  Propanoate metabolism
mety00650  Butanoate metabolism
mety00903  Limonene and pinene degradation
mety00930  Caprolactam degradation
mety01100  Metabolic pathways
mety01110  Biosynthesis of secondary metabolites
mety01120  Microbial metabolism in diverse environments
mety01130  Biosynthesis of antibiotics
mety01200  Carbon metabolism
mety01212  Fatty acid metabolism
Module
mety_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mety00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    MRY16398_15660 (fadJ)
   00650 Butanoate metabolism
    MRY16398_15660 (fadJ)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    MRY16398_15660 (fadJ)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MRY16398_15660 (fadJ)
   00310 Lysine degradation
    MRY16398_15660 (fadJ)
   00380 Tryptophan metabolism
    MRY16398_15660 (fadJ)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MRY16398_15660 (fadJ)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MRY16398_15660 (fadJ)
   00281 Geraniol degradation
    MRY16398_15660 (fadJ)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MRY16398_15660 (fadJ)
   00930 Caprolactam degradation
    MRY16398_15660 (fadJ)
Enzymes [BR:mety01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     MRY16398_15660 (fadJ)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     MRY16398_15660 (fadJ)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     MRY16398_15660 (fadJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 LSDAT_euk
Motif
Other DBs
NCBI-ProteinID: BBE76510
UniProt: A0A348DAJ3
LinkDB All DBs
Position
1661436..1663583
Genome map
AA seq 715 aa AA seqDB search
MDMTSAFTLVVRPDNVAVVSIDVPGEKMNTLKAEFGSQVRAILKQIRENKQIRGVVFISA
KPDNFIAGADINMIDRCKTAKEAEDLARQGQQIMAEIHALSIPVIAAIHGPCLGGGLELA
LACHRRICTDDVKTVLGLPEVQLGLLPGSGGTQRLPRLVGVSTALDMILTGKQLRARQAL
KAGLVDDVVPVSILLDAATELAAQDRPASRSLPVRERLLAGPLVRALLFRMVAKKTEQKT
QGNYPATTRILNVIETGLSQGSSSGYDAEARAFGQLAMTPQSQALRHIFFASTEVKKDPG
SPVAAGPLRSVGVLGGGLMGGGIAYVTAVKGNLPVRIKDINPKGINHALKYSWEQLDKKV
RRRHLKSAERDAQMARISGTTDYSGFSHRDVVIEAVFEDLTLKQQMVAEIEAQCAPQTIF
ASNTSSLPIGDIAARAARPGNIIGLHFFSPVEKMPLVEVIPHAGTDEQTISTVVKLAKKQ
GKTPIVVADKAGFYVNRILAPYMSEAMRLLSEGERIENIDKALVKFGFPVGPIQLLDEVG
IDTGTKIIPVLEAAYGDRFSAPASVVSAILNDDRKGRKNERGFYLYGKKGRKSNKQPDPA
IYPLVGASGTGKLSAEQIAERCVMMMLNEAARCFAEKVIRSPRDGDIGAVFGIGFPPFLG
GPFRYMDTLGAGDIVATLQRLASLYGERFAPCQLLLQMAEQGEKFWDKQETDFVS
NT seq 2148 nt NT seq  +upstreamnt  +downstreamnt
atggacatgacctcagcatttaccctcgttgtacgcccggacaatgttgccgttgtcagt
attgatgttcccggcgaaaagatgaacacgctaaaggcggagtttggcagccaggtacgc
gccatccttaaacaaattcgtgaaaacaaacagattcgcggcgtggtgttcatttccgca
aaaccggataattttatcgccggggcggatatcaacatgatcgatcgctgcaaaacggcg
aaagaggccgaagatctggcgcgccaggggcagcagatcatggccgagatccacgcgctg
tcgatcccggtgatcgccgccatccatggcccatgtcttggcggcggtctggaactggca
ttagcctgccatcgccgaatttgtacggatgatgtgaagacggtcctggggctgcccgaa
gtgcagcttggtctgctgcctggttctggtggcacccagcggctgccgcgtctggtcgga
gtaagcactgcactggatatgatcctgaccggtaaacaactgcgcgcgcgccaggcgtta
aaagccgggctggttgatgatgtcgtgccggtgtccattttgctggatgctgccacagag
cttgccgcgcaggaccgtcctgccagccgcagcctgccggtacgtgaacgtctgctggcc
gggccgctggtccgcgcgctgttattccgcatggtcgcaaaaaaaaccgagcaaaaaacc
cagggcaactaccccgcgacgacccgtattctgaatgttatcgaaacgggcttaagccag
ggcagtagcagtggttatgacgccgaagcacgcgcgtttggtcaactggctatgaccccg
caatcgcaggcgctgcggcatattttctttgccagcactgaggtgaaaaaagaccccggc
agcccggttgccgccggtccgctgcgctctgttggtgttctcggcggtgggttaatgggc
ggcgggatcgcctacgtgacggcagtgaagggtaatctcccggttcgcataaaagatatt
aatccgaaaggcattaaccacgcgctgaaatatagctgggaacagcttgataaaaaggtg
cgtcgccgccatctcaaatctgctgagcgtgatgcgcaaatggcgcgcatttccggtact
acggactacagcggtttttcccatcgggatgtggtgatagaggccgtattcgaagatttg
actcttaagcaacagatggtggcggagattgaagcgcagtgtgcgccgcagaccattttt
gcctccaatacgtcgtcattgccgatcggtgatattgcggccagggccgcgcgccctggc
aatattatcggattacatttttttagcccggttgagaagatgccattggtggaagtcatt
ccccatgccggtactgatgaacagaccatttcgacagtggtgaaactggcgaagaagcag
ggcaaaacgccgatcgtcgtggcggacaaagcgggtttttacgtgaaccgcattctggcg
ccttatatgagcgaagcgatgcggctcctgagcgaaggggaacgtatcgagaatatcgat
aaggcgctggtaaaatttggctttcctgtcggcccaatccaacttttggatgaagtgggc
atcgacaccgggactaaaattatccctgtactggaggctgcttatggtgatcgttttagt
gcccctgcaagcgtcgtttctgcaatattgaatgacgatcgcaaaggcagaaaaaatgag
cgcggtttctatctttacggtaagaaagggcgtaaaagcaacaaacagcctgacccggca
atttacccgcttgtgggggcatctggcacaggcaaattatcggcagaacagattgccgaa
cgatgcgtcatgatgatgcttaacgaggccgcacgctgtttcgccgagaaggtgattcgc
agcccgcgagatggtgatattggcgcggtgtttggcatcggttttccgcctttcctgggc
ggcccgttccgctatatggatacccttggcgcgggtgatattgtcgcaactctgcagcgc
ctggcttcgctttatggggaacgttttgcaccttgtcagcttttgttacaaatggctgag
cagggcgaaaagttttgggacaagcaggaaactgattttgtaagttaa

DBGET integrated database retrieval system