KEGG   Metakosakonia sp. MRY16-398: MRY16398_31680Help
Entry
MRY16398_31680    CDS       T05735                                 

Definition
(GenBank) acetylornithine deacetylase
  KO
K01438  acetylornithine deacetylase [EC:3.5.1.16]
Organism
mety  Metakosakonia sp. MRY16-398
Pathway
mety00220  Arginine biosynthesis
mety01100  Metabolic pathways
mety01110  Biosynthesis of secondary metabolites
mety01130  Biosynthesis of antibiotics
mety01210  2-Oxocarboxylic acid metabolism
mety01230  Biosynthesis of amino acids
Module
mety_M00028  Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:mety00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    MRY16398_31680
Enzymes [BR:mety01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.16  acetylornithine deacetylase
     MRY16398_31680
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer
Motif
Other DBs
NCBI-ProteinID: BBE78112
UniProt: A0A348DF45
LinkDB All DBs
Position
3292348..3293505
Genome map
AA seq 385 aa AA seqDB search
MMTSREMLEQLVAFNTTSRESNLALIEFVGRYLTGLGVDYELIHNAEGSKANLYARLGPP
GHGGVMLSGHSDVVPVDGQNWSVPPFALTERDGKLYGRGTADMKGFIACILAAIPHFLAQ
PLAQPLHLAISYDEEVGCLGVRTLLDALSHRADKPAICLIGEPTELQPVLGHKGKLGVRC
EVQGAACHSAYAPQGVNAIEYAAKLIHHLTLIGQRLAAPEHHDARFDPPFTTVQTGLIQG
GRALNIVPADCTFDFEVRTLPQDDAQEVARELESYAQRELLPAMHAVNRDAAIRFYPISS
YPGLYTAAQSAAARLVAHLTGSEKFSTVAFGTEGGLFHQSGIPSVICGPGSMAQGHKPDE
FITVEQLNACDALLRRLATWMCQKR
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgatgaccagccgtgaaatgctggaacaactggtggcgtttaacaccaccagccgagaa
tcgaatctggcgctgatcgaatttgtcgggcgctatttaaccgggctcggcgttgattac
gaattgattcacaacgccgaaggcagcaaagccaatctgtatgcgcggcttggcccgccg
ggtcacggtggcgttatgctatcgggccacagcgatgtggtgcccgttgacgggcagaac
tggagcgtcccccccttcgccctgacggagcgcgatggcaaactgtatggccgtggcacc
gcggacatgaaaggctttattgcctgcattctcgccgccatcccccactttcttgcgcag
ccgctggcgcaaccgctgcatctggcgatttcgtatgatgaggaagtcgggtgcctcggg
gtgcgaacattgctggatgcgctctcccatcgtgcggacaagcccgctatctgcctgatt
ggcgaacccactgaactgcaaccggttcttggtcacaaaggcaaactcggcgtgcgttgt
gaagtccagggcgccgcctgccactcggcttatgcgccgcagggtgtcaatgccatcgaa
tatgccgcaaaacttatccatcatctgacgctaatcggccagcggctggccgcgccggag
catcatgatgcgcgttttgatcccccttttactacggtgcaaacgggtcttatccagggt
ggccgggcgctgaatatcgtgcccgccgactgtacctttgactttgaggtgcgaacattg
ccgcaggatgatgcgcaggaggtggcccgtgagctggaaagttacgcacagcgcgaactc
ctgcccgcaatgcacgcggtaaatcgtgatgcagcgatccgcttttatcccatcagtagt
taccccggtttgtacaccgctgcgcaaagtgccgccgcacggctggtcgcccatctcacc
ggatcggaaaaattcagcaccgtcgccttcgggaccgaaggcgggttgttccatcagtcc
ggtattcccagcgtgatatgcgggccaggcagtatggcgcagggccataaaccggatgag
ttcattaccgtcgaacagctaaacgcctgtgacgccctgctacgccgtcttgcgacctgg
atgtgtcaaaaaagataa

DBGET integrated database retrieval system