KEGG   Metakosakonia sp. MRY16-398: MRY16398_41120Help
Entry
MRY16398_41120    CDS       T05735                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
mety  Metakosakonia sp. MRY16-398
Brite
KEGG Orthology (KO) [BR:mety00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    MRY16398_41120
Enzymes [BR:mety01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     MRY16398_41120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_binding_2 HI0933_like Thi4 FAD_oxidored K_oxygenase NAD_binding_8 FAD_binding_3 DAO Glutaredoxin FMO-like AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: BBE79056
UniProt: A0A348DHT9
LinkDB All DBs
Position
complement(4265084..4266649)
Genome map
AA seq 521 aa AA seqDB search
MLDTNMKTQLKAYLEKLTKPVELIATLDDSARSAEIKELLAEIAELSDKVSFKEDNTLAV
RKPSFLITNPGSNQGPRFAGSPLGHEFTSLVLALLWTGGHPSKEAQSLLEQIRDIDGDFE
FETYYSLTCHNCPDVVQALNLMAVLNPRIKHTAIDGGTYQNEITDRNVMGVPAVFVNGKE
FGQGRMTLAEIVAKIDTGAEKRAAEELNKRDAYDVLIVGSGPSGAAAAVYSARKGIRTGL
MGERFGGQVLDTVDIENYISVPKTEGQKLAGALKAHVSEYDVDVIDSQSATKLTPAAVEG
GLHQIETASGAVLKARSIIIATGAKWRNMNVPGEEQYRTKGVTYCPHCDGPLFKGKRVAV
IGGGNSGVEAAIDLAGIVEHVTLLEFAPEMKADQVLQDKVRSLGNVDIILNAQTTEVKGD
GSKLTGLEYRDRVSGDVHHIALAGIFVQIGLLPNTTWLEGAIERNRMGEIIIDAKCETSV
KGVFAAGDCTTVPYKQIIIATGEGAKASLSAFDYLIRTKRA
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacacaaacatgaaaacgcagctcaaggcttaccttgagaaactgactaaacct
gttgagctgattgccacgctggatgacagcgccagatcggcagagatcaaggaactgttg
gctgaaattgctgaactgtcagataaagtttctttcaaagaagacaacacgctggcagtg
cgcaaaccgtcgttccttattaccaacccaggttcaaaccaggggccgcgctttgcaggc
tcgccgctgggtcacgaatttacctcactggttctggcactgttgtggaccggtggtcac
ccgtcgaaagaagcgcagtctctactcgaacagattcgcgatatcgacggtgattttgaa
tttgaaacctattactcactgacctgccataactgcccggatgtcgtacaggcgcttaac
ctgatggcagtgttgaacccgcgcattaaacatacggcgattgatggcggcacctaccag
aatgaaatcactgaccgtaatgtgatgggcgttccggctgtcttcgtcaatggtaaagag
tttggtcaggggcgtatgacgcttgctgaaatcgtggccaaaattgataccggcgcggaa
aaacgtgccgcagaagagctgaacaagcgtgacgcgtatgatgtgctgattgtcggttcc
ggcccgtctggtgcggcggcagcagtttactccgcacgtaagggtatccgtaccgggctg
atgggtgagcgttttggtggtcaggtgctggacaccgtggacatcgaaaactacatctcc
gtgccgaagaccgaaggtcaaaaactggcgggcgcactgaaagcccacgtgtcggaatac
gacgttgatgtgattgattcgcaaagtgcgaccaaactgaccccggctgccgtggaaggt
ggtttgcatcagattgaaaccgcatccggtgccgtactgaaagcacgcagtatcatcatt
gcgactggggcaaaatggcgcaacatgaacgtgccgggcgaagaacagtatcgtactaaa
ggtgtgacctactgcccgcactgcgatggtccgctgtttaaaggtaaacgtgttgcggtc
atcggcggcggtaactcaggtgtggaagccgctatcgatctggcgggcattgtagaacat
gtcaccctgctggagtttgcgcccgaaatgaaagctgaccaggtgctgcaggataaagtg
cgtagcctcggtaatgtcgacatcatcttgaatgcgcaaactaccgaagtgaaaggcgat
ggcagcaaactgacggggctggagtaccgcgatcgcgtgagcggcgatgtgcatcatatc
gcgctggccggtatcttcgtgcagattggtttactgccgaatactacctggctggaaggt
gccattgagcgcaaccgtatgggcgaaattatcattgatgcgaaatgtgaaaccagcgtc
aaaggtgtgttcgcggcgggtgactgcaccacggtgccgtacaagcaaattattatcgcc
acaggcgaaggtgcgaaagcctctctgagcgcattcgactacctgatccgcactaagcgt
gcataa

DBGET integrated database retrieval system