KEGG   Metakosakonia sp. MRY16-398: MRY16398_47260Help
Entry
MRY16398_47260    CDS       T05735                                 

Gene name
ddl1
Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
mety  Metakosakonia sp. MRY16-398
Pathway
mety00473  D-Alanine metabolism
mety00550  Peptidoglycan biosynthesis
mety01100  Metabolic pathways
mety01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:mety00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    MRY16398_47260 (ddl1)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    MRY16398_47260 (ddl1)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    MRY16398_47260 (ddl1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:mety01011]
    MRY16398_47260 (ddl1)
Enzymes [BR:mety01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     MRY16398_47260 (ddl1)
Peptidoglycan biosynthesis and degradation proteins [BR:mety01011]
 Precursor biosynthesis
  Amino acid ligase
   MRY16398_47260 (ddl1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp_4 ATP-grasp_3 ATP-grasp ATPgrasp_YheCD TTL
Motif
Other DBs
NCBI-ProteinID: BBE79670
UniProt: A0A348DJK3
LinkDB All DBs
Position
complement(4930101..4931021)
Genome map
AA seq 306 aa AA seqDB search
MADKVAVLLGGVSAEREVSLNSGAAVLAGLREGGVDAHPIDPRDVDVTRLKAMGFDKAFI
ALHGRGGEDGTLQGLLEITGVPYTGSGVMASAISMDKLRSKLLWQGAGLPVAPWVALTRS
EFESGLNNDVIQRIDALGLPVIVKPSREGSSVGMSKVEESGALTAALALAFQHDDEVLIE
KWLSGPEFTVAMLGKEILPSIRIQPAGTFYDYEAKYLSDETKYFCPSGLEAEDEANLQNL
VLKAWRALGCRGWGRIDAMLDSDGQFYLLEANTAPGMTSHSLVPMAARQAGLTFSQLVVR
ILELAE
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atggctgataaagtcgcggtcctgctgggcggggtttctgctgagcgtgaggtgtcatta
aactccggcgctgcggtgcttgcgggtttacgtgaggggggcgttgatgcccacccgatt
gacccgcgtgatgtggatgtcactcgcctgaaagcgatgggcttcgataaggcattcatt
gcgctgcacgggcgtggcggcgaagacggtacgctgcaaggattgctggagataacaggg
gtgccctataccggcagcggtgttatggcgtcggcaatctcaatggataaattgcgcagt
aaattgctctggcaaggtgcagggttaccggtcgccccgtgggttgcattaacacgcagc
gaatttgaatcgggactcaataacgacgttattcagcgcattgatgcgttaggtttaccg
gttatcgttaaaccgagccgtgaaggctcaagtgtcgggatgtcaaaagttgaagaatct
ggtgcgttaacggctgcgttagcgcttgcctttcaacatgatgatgaagttcttatcgaa
aaatggctaagtggacccgaatttacagttgccatgctcggaaaagaaattttaccgtca
attcgcattcagcccgctggaaccttctatgattatgaggcgaagtatctctctgatgag
acaaaatatttctgtccgtcaggtctggaagcagaagatgaggccaatttacaaaacctg
gtactgaaagcctggcgtgcgctgggatgtcggggctggggaagaattgacgctatgtta
gacagtgatgggcagttttatctgctggaagccaataccgcgccgggtatgacgagtcat
agcctggtcccgatggcagcgcgacaggcggggttaaccttctcgcagttggtcgtgcga
attctggaactggcggagtga

DBGET integrated database retrieval system