KEGG   Metakosakonia sp. MRY16-398: MRY16398_48750Help
Entry
MRY16398_48750    CDS       T05735                                 

Gene name
mdoB
Definition
(GenBank) phosphoglycerol transferase I
  KO
K01002  phosphoglycerol transferase [EC:2.7.8.20]
Organism
mety  Metakosakonia sp. MRY16-398
Brite
KEGG Orthology (KO) [BR:mety00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    MRY16398_48750 (mdoB)
Enzymes [BR:mety01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.20  phosphatidylglycerol---membrane-oligosaccharide glycerophosphotransferase
     MRY16398_48750 (mdoB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sulfatase DUF4381 DUF4131
Motif
Other DBs
NCBI-ProteinID: BBE79819
UniProt: A0A348DK02
LinkDB All DBs
Position
5096640..5098931
Genome map
AA seq 763 aa AA seqDB search
MSELLSIVLFLASVAIYASKAGRNTWWFTAILLVLGFFVLLNITLYASNYFTGDGINDAV
IYTLTNSLTGAGVRKYLLPGAVLVLALTAVFGALAWILRRRRHRPYHFGYSLLALLMALA
SVDASPAFHQITELVKSQSREGDPDFAEYYREPAKKIPNPKLNLVYIYGESLERTYFDDE
AFPGLAPELGALKEEGLDFSQTEQLPGTDYTIAGMVASQCGIPLFAPFEGNASASVSSFF
PQNTCLGDILKNSGYQNYFVQGANLRFAGKDVFLKSHGFDYLVGAEELKGEVSDPKYRND
WGFYDDTVLDEVWKKYEALSRSGQRFSLFALTVDTHHPDGFISRTCSRKSYSYDGKPNQS
FSAVTCSQQHIAALINKIKASPWFKDTVIVVSSDHLAMNNTAWKYLNKEDRKNLFFVLRG
DEPQQDTLAVKRSTMDNGATVLDILGGDNYLGLGRSSLSGQSLSGEFLNMKEKIVAWKPD
IIRLWNFPKQMKDFTIDRDKKMIAFSGSNFRLPLLVRVSSKRIEPIPESEYSAPLRFQLA
DFAPRDNFVWVDQCYKMARLWAPELVLSTDWCVSQGQLGGEQKVQAVDKDQWKGKTAFKD
TVISTDRYKQNVDMLKIVDDDIRYKADSFVFNVAGAPEEVKKFSGISRPESWGRWSNAQL
GNEVEIEFNDPLPASFDLVITAKAYGANANRPIPVRVGDEEQTLMLGNDVSTTTLRFNNP
TRSNTLVIVPPEPESTNEGNILGHSPRKLGIGMVEIKVVESAG
NT seq 2292 nt NT seq  +upstreamnt  +downstreamnt
ttgtccgagttactttctattgttctatttctcgcgtccgtggcgatttacgcctctaaa
gcgggccgtaatacctggtggttcactgcaatattgctggtgctgggtttctttgtcctg
ctaaacatcaccctctacgccagtaactacttcactggcgatgggatcaatgatgcggtt
atctacacgctgaccaatagcctcacgggcgcgggggtgcgcaaatatctgctgcccggt
gcagttctggttctcgccctgacggcggtttttggcgcgctggcctggatactacgccgt
cgtcgccaccgcccttatcacttcggttacagcctgctggcactgctgatggcactggcc
tccgtagacgccagcccggcatttcatcagattactgaactcgtaaaatcgcagtctcgt
gaaggcgatcctgatttcgcagaatattatcgcgaaccggcgaaaaagatccccaatcca
aagctgaacctggtctatatctacggcgagagtctggaacgcacctatttcgatgatgag
gcgtttcccggcctggcacctgagctgggcgcattaaaagaagaaggtctggatttctcg
caaacggaacaactgcccggtacggattacaccattgccggaatggtcgcctctcagtgc
ggtatccccctgtttgcgccgtttgaaggtaacgcatctgcgtccgtttccagctttttc
ccgcagaacacctgccttggcgatatcctgaaaaactccggctaccagaactattttgtt
cagggcgcgaacctgcgctttgccggtaaagatgtgtttcttaaatcacatggctttgac
tatttggtcggcgcagaagagttaaaaggcgaagtaagcgatccgaaataccgcaatgac
tggggcttttacgacgacaccgtgctggatgaagtgtggaaaaagtacgaggcgctatcc
cgttccgggcaacgtttctcattgtttgcgttaactgtcgatacccaccacccggacggt
tttatctcccgaacctgtagtcgtaaaagctatagctatgacggtaaaccaaaccagtcg
tttagcgccgtaacctgtagccaacagcatattgccgcgctgattaacaaaatcaaagcc
tcgccctggtttaaagatacggtcattgtggtctcttccgatcatctggccatgaacaac
accgcctggaaatacctgaacaaagaggatcgtaagaacctgtttttcgttctgcgtggc
gatgagccacagcaggacacgctggccgtgaaacgcagcaccatggataacggcgctacg
gtgctggacattctcggtggcgataactacctcggccttgggcgcagcagcctgtccggg
cagtcgctttccggcgagttcctgaatatgaaagagaaaatcgtcgcctggaagcccgat
atcattcgtctgtggaatttcccaaaacagatgaaagacttcactatcgatcgcgataaa
aagatgatcgccttctccggcagtaatttccgccttccactactggtacgcgtgtcatca
aaacgcatcgaacctatcccggaaagcgaatactctgcgccgctgcgtttccagctcgcc
gatttcgccccacgcgataactttgtctgggttgatcaatgctacaagatggcccgcctg
tgggcgccggagctggtgctttccaccgactggtgtgtatcgcaagggcagcttggcggt
gaacagaaagtccaggcggtcgacaaagatcagtggaaaggcaaaaccgctttcaaagac
accgtcatcagcaccgaccgttacaagcaaaatgtggatatgctcaaaattgtcgatgac
gacatccgctacaaagccgacagctttgtcttcaacgtggcaggcgcgcctgaggaagtg
aaaaaattcagcggtatttctcgcccggaaagctggggacgctggtcgaatgcgcagctc
ggcaacgaagtcgaaattgaatttaatgacccgttgccagcatcctttgacctggtgatc
accgcaaaagcctatggtgcaaacgccaaccgccctattccggtaagagtcggcgatgag
gaacaaacgctgatgctgggcaacgatgtttccactaccacgttacgtttcaacaacccg
acacgcagcaatacgctggtaattgtgccgccggaacccgagtcgaccaatgaggggaat
attctcggccactctccacgtaaactcggtatcgggatggtggaaatcaaagtcgttgaa
tccgcaggataa

DBGET integrated database retrieval system