KEGG   Metakosakonia sp. MRY16-398: MRY16398_52340Help
Entry
MRY16398_52340    CDS       T05735                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
mety  Metakosakonia sp. MRY16-398
Pathway
mety00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:mety00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    MRY16398_52340
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mety02000]
    MRY16398_52340
Enzymes [BR:mety01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     MRY16398_52340
Transporters [BR:mety02000]
 Other Transporters
  Pores ion channels [TC:1]
   MRY16398_52340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_3 GST_C GST_C_2 Tom37
Motif
Other DBs
NCBI-ProteinID: BBE80178
UniProt: A0A348DL11
LinkDB All DBs
Position
complement(5464339..5465007)
Genome map
AA seq 222 aa AA seqDB search
MLKVHHLNQSRSQRILWALEELGLPYQLIHYQREKTMLAPASLKKVHPLGKSPVLEDDGL
ILAESGAILEYLQETYDTNSLLKPEDREMRQQYRFWLHYAEGSLMPLLLMKLVFASLGKP
PVPFGVRTIGKMLGQGIQKAWLNKQIETHARYIESQLAVKPWFAGEQLSMADIQMSFPIF
ALLSRGGIADLPHTQSWKKRVEMRPAWQRAIEQGGPLDLPGT
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgcttaaagttcaccacttgaaccagtctcgttctcagcgcattctgtgggcgctggaa
gaactgggtttaccgtatcaactcattcattatcaacgtgaaaaaaccatgctggctcct
gcgtcacttaagaaagtgcacccgctgggcaaatcaccggtactggaagacgacggtctg
atcctcgctgaatccggcgcaattctggaatacctgcaggagacctacgatacaaacagc
ctgcttaagcctgaagatagagagatgcgtcagcagtatcgcttttggctgcattacgcc
gaaggatcgctgatgcctttattattgatgaagctggtttttgccagcctcggtaaacca
cccgtaccgtttggtgtgcgaacgataggaaaaatgcttggtcagggcatccagaaagcc
tggctaaacaagcaaattgaaacccacgcgcgttatatcgagtcgcaactggccgtgaag
ccctggtttgccggagagcagttaagcatggccgacattcagatgagttttccgattttc
gcattgctgtcacgcggcggcattgccgatcttccgcatacccagtcatggaaaaagaga
gttgaaatgcgcccggcctggcaacgggcgattgagcagggcggccctttggatctcccc
ggtacgtaa

DBGET integrated database retrieval system