KEGG   Methylophilus sp. TWE2: ACJ67_06300Help
Entry
ACJ67_06300       CDS       T04002                                 

Definition
(GenBank) DNA ligase
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
meu  Methylophilus sp. TWE2
Pathway
meu03030  DNA replication
meu03410  Base excision repair
meu03420  Nucleotide excision repair
meu03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:meu00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    ACJ67_06300
   03410 Base excision repair
    ACJ67_06300
   03420 Nucleotide excision repair
    ACJ67_06300
   03430 Mismatch repair
    ACJ67_06300
Enzymes [BR:meu01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     ACJ67_06300
    6.5.1.6  DNA ligase (ATP or NAD+)
     ACJ67_06300
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     ACJ67_06300
DNA replication proteins [BR:meu03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    ACJ67_06300
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     ACJ67_06300
DNA repair and recombination proteins [BR:meu03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     ACJ67_06300
   NER (nucleotide excision repair)
    Other NER factors
     ACJ67_06300
   MMR (mismatch exicision repair)
    Other MMR factors
     ACJ67_06300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_OB_2 DNA_ligase_A_M mRNA_cap_enzyme
Motif
Other DBs
NCBI-ProteinID: AKR43080
UniProt: A0A0K0SUX6
LinkDB All DBs
Position
1305133..1305972
Genome map
AA seq 279 aa AA seqDB search
MLRLIRHFLLLCCFFGAVHVHAQAPAILLAQIYNEDIPVQDYLVSEKLDGIRAIWDGQQL
ISRHGHPIHAPAWFTKNFPAQMLDGELWIARSRFEQLSSTVRQSNPNDAAWRQVAYYVFE
LPEAEGDFSQRVQRIAEIARQVHSPYLKPLPQFRVSDRTKLKRTLDSIVAKRGEGLMLHR
ADAPYLTGRSHVLLKLKPQLDAEAKVIAYVPGKGKYQGKMGALLVEMPDGTQFKLGTGFK
DAERAHPPPIGSQVTYTYRDVTKNGKPKFASFLRVRPPE
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgctacggctaatccgtcatttcctgcttctatgttgtttttttggggcggtacacgtc
catgcacaagcacctgccattttgctggcgcagatttacaacgaggatatcccggtacaa
gattacctggtcagtgaaaagctggatggtattcgtgcaatttgggatggacagcaactg
atcagccggcatggacatcctatccatgccccggcatggtttaccaaaaactttccagcg
caaatgttagatggtgaattatggattgcacgtagccgttttgaacagctttcttctact
gtcaggcagtcgaatcccaatgatgcggcctggcggcaagttgcctattatgtctttgaa
ttgccggaggccgaaggtgatttctcccagcgcgtgcagcggattgcggaaatcgcccgg
caagtgcatagcccttatctcaaacctctgccacagttccgcgtaagcgacaggactaaa
cttaagcgtacgctggacagcattgtcgccaagcgcggcgagggcctgatgttgcaccga
gccgatgcgccatacctcactggtcgcagccatgtgttactcaagctcaaaccacaactg
gatgcagaagccaaagtcattgcctatgtccccggcaaaggcaagtatcaaggtaaaatg
ggcgcattactggtagaaatgccggatggaactcagttcaagttagggacaggtttcaaa
gatgccgaacgtgcccatccaccgccgataggcagtcaggtcacgtatacttatcgggat
gtgactaaaaacggcaaacccaaatttgccagttttttgcgggtacgcccgcccgaataa

DBGET integrated database retrieval system