KEGG   Methylophilus sp. TWE2: ACJ67_07545Help
Entry
ACJ67_07545       CDS       T04002                                 

Definition
(GenBank) enoyl-ACP reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
meu  Methylophilus sp. TWE2
Pathway
meu00061  Fatty acid biosynthesis
meu00780  Biotin metabolism
meu01100  Metabolic pathways
meu01130  Biosynthesis of antibiotics
meu01212  Fatty acid metabolism
Module
meu_M00083  Fatty acid biosynthesis, elongation
meu_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:meu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    ACJ67_07545
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    ACJ67_07545
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    ACJ67_07545
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:meu01004]
    ACJ67_07545
Enzymes [BR:meu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     ACJ67_07545
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     ACJ67_07545
Lipid biosynthesis proteins [BR:meu01004]
 Fatty acid synthase
  Component type
   ACJ67_07545
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short
Motif
Other DBs
NCBI-ProteinID: AKR43296
UniProt: A0A0K0SVQ4
LinkDB All DBs
Position
complement(1556688..1557473)
Genome map
AA seq 261 aa AA seqDB search
MAFLAGKKILIAGLLSNRSIAYGIAAAMKREGAELAFTYQVDKHEKRVRDLAADFESEIV
LPCDVAEDAQIDNLFVELAKVWDGLDGLVHSIAFVPKVALDGDYLDNIDREYFRIAHDIS
SYSFSGMAKAAYPMMQGRNGSLLTISYLGAERTMPNYNVMGVAKASLEANVRYLAQSLGP
RGIRVNAVSAGPIKTLAASGIADFDKMIGFNEKHAALRRNVTIEEVGNVAAFLASDLASG
VTGEITYVDGGMNITAAGQID
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atggcatttcttgctggaaaaaaaatcctgattgccggtttgctgagcaaccgttcaatc
gcttatggcatcgcagccgcaatgaaacgtgaaggggccgagctggcctttacctatcaa
gtcgacaaacatgaaaagcgtgtgcgcgacctggctgctgacttcgaatccgagatcgtt
ttaccgtgtgacgtcgccgaagatgcgcaaatcgacaacctgtttgtcgagctggctaaa
gtgtgggatggtctggatggcctggtgcactcgattgctttcgtgcctaaagttgcttta
gatggtgactacctcgacaacatcgatcgcgaatacttccgtatcgcccacgatatcagc
tcctacagcttctccggtatggccaaagccgcctacccgatgatgcaaggccgcaacggc
agcctgctcaccatcagctacttgggtgctgaacgcaccatgcctaattacaacgttatg
ggcgtggccaaagccagcctggaagccaacgtccgctatctggcacaaagcctgggccca
cgcggcatccgcgtcaacgcagtttctgccggcccaatcaaaaccctggctgcctcaggc
attgcagacttcgacaaaatgatcggcttcaacgaaaaacacgccgccctgcgccgcaat
gtgactattgaagaagttggcaacgtcgccgccttcttggccagtgacctggcttctggc
gtgactggtgaaattacttacgtagatggtggtatgaatatcactgctgcaggtcagatc
gattaa

DBGET integrated database retrieval system