KEGG   Methylophilus sp. TWE2: ACJ67_08960Help
Entry
ACJ67_08960       CDS       T04002                                 

Definition
(GenBank) phosphoenolpyruvate phosphomutase
  KO
K01841  phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
meu  Methylophilus sp. TWE2
Pathway
meu00440  Phosphonate and phosphinate metabolism
meu01100  Metabolic pathways
meu01120  Microbial metabolism in diverse environments
meu01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:meu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    ACJ67_08960
Enzymes [BR:meu01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     ACJ67_08960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEP_mutase CTP_transf_like
Motif
Other DBs
NCBI-ProteinID: AKR43540
UniProt: A0A0K0SWA4
LinkDB All DBs
Position
1861517..1862815
Genome map
AA seq 432 aa AA seqDB search
MASVYVGMTVDILHHGHINIIEQARKYGDVTIGLLSDAAVADHKRLPYLTYEQRKQIVSN
IRGVVNVVPQEEWDYAPNLLKYKPDIMVHGDDWLEGPLVPYRDRARAALAEYGGHLIEIP
YTRGVSSNEMLSQIQALGTTPDIRRRTLKRLLTVKPLSRFIEAHNPISALIAEHVTAQRN
GKTCQFDGFWSSSLTDSTARGKPDIEAVEINSRLSNINDIFDVTTKPLIMDADTGGKLEH
FELNVRSMERLGISATIIEDKIGLKKNSLFGNEVPQLQDEIEPFCEKIAAGRAARVSDDF
MVIARIESLILEKGIADAVQRAQAYVGAGVDGIMIHSRQKTPDEVFEFAKIFKSEFPTTP
LVCVPTSYNTVTEEELALRGFNLVIYANHMMRAAYPAMQNAAMEILKNGRTAEIESSLMS
INDVLELIPGTK
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atggcatccgtttatgtaggtatgactgtagacattctgcaccatggccatatcaatatt
attgagcaggcgaggaagtatggcgacgtgacgattggccttttgtcagacgcagcggtg
gcagaccataaacgcctgccctacctgacctatgaacagcgcaaacagatcgtcagcaat
attcgtggtgtagtgaatgtcgtgccgcaggaagaatgggattacgcgcctaacctgctc
aaatacaaaccagacatcatggtgcatggtgatgactggctggaaggtcctttggtgccc
taccgtgaccgcgcccgtgcagcgctggctgaatatggtggccacctgatcgagattcct
tatacacgcggtgtgtcttccaatgaaatgttgagccagatccaggcccttggtaccaca
ccggatatccgtcgccgcaccttgaaacgcctgctgacggtcaaaccgctttcacgcttt
attgaggcacacaacccgatctcggcattgattgccgaacacgtcacagcacagcgcaat
ggcaaaacctgccagtttgacggattctggtccagttcattaacggattccaccgcgcgt
ggcaaacctgatattgaagcagtggagatcaacagccgcttatccaatatcaatgacatc
tttgatgtcaccaccaaacctttaattatggacgccgataccggcggcaaactggagcat
tttgagctcaatgtgcgcagcatggaacgcctgggtatttctgccaccatcatcgaagac
aagatcggcctcaaaaagaattctttgtttggtaatgaagtaccgcaattgcaggacgag
atcgagcctttctgcgaaaaaatcgctgctgggcgcgctgcgcgtgtcagcgatgatttt
atggtgattgcgcgtatcgagagcctgattctggaaaaaggcattgccgatgccgtgcaa
cgcgcacaagcctacgtcggtgcgggtgtagacggcatcatgattcacagccgccagaaa
acgccagacgaagtctttgaattcgccaagattttcaaatcagagttcccaacgacgcct
ttagtgtgtgtgcccaccagttacaacaccgtgacggaagaagaactggccttgcgcggt
ttcaatctggtgatttatgccaaccacatgatgcgtgcggcctatccggccatgcaaaat
gcggccatggaaatccttaaaaacggcaggaccgcagaaattgagtccagcctgatgtcg
attaacgatgtactggaactgatcccaggcactaaatag

DBGET integrated database retrieval system