KEGG   Methylophilus sp. TWE2: ACJ67_13260Help
Entry
ACJ67_13260       CDS       T04002                                 

Definition
(GenBank) NADH dehydrogenase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
meu  Methylophilus sp. TWE2
Brite
KEGG Orthology (KO) [BR:meu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    ACJ67_13260
Enzymes [BR:meu01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     ACJ67_13260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 HI0933_like FAD_oxidored FAD_binding_3 DAO Thi4 NAD_binding_7 AlaDh_PNT_C NAD_binding_8 K_oxygenase Glutaredoxin
Motif
Other DBs
NCBI-ProteinID: AKR44268
UniProt: A0A0K0SY69
LinkDB All DBs
Position
complement(2805535..2807100)
Genome map
AA seq 521 aa AA seqDB search
MLDDTLKAQLQTYLGMLRQPIRLIASLDGSERAAEMRELLQEIAALSDKVSLDETGDDAR
KPSFVIAKEGETHGVRFAAIPLGHEFTSLVLALLWTGGHPPKVEQDVLDQIKALDSDLNF
EVYMSLSCHNCPDVVQATTLMTVFNPRINTTVIDGALFQDEVNERNIMAVPATFLNGETF
ASGRMLVEEILAKVDTGAVAKEAEKLNAREPFDVLVVGGGPAGASAAIYAARKGIRTGIV
AERFGGQVNDTLAIENFISVKETDGPKLVAALEEHVKTYDVDIMPLQRAVGLAEPAKADN
KHAGLIEVKLESGATLRSKSVILATGARWKNLNVPGESEYKNKGVAYCPHCDGPLFKGKH
VAVIGGGNSGVEAAIDLAGVVGHVTLLQFDTELKADAVLQRKLRSLENVTILTSAQTTEI
TGDGTRVNGLTYTDRVSGESKHVALEGVFIQIGLVPNSDWLKGTLDLSKYGEIEINHHNA
TSLPGVFAAGDVTTIPYKQIIIAMGEGSNAALGAFDYLIRQ
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgttagatgacaccttaaaggcccagttgcaaacctacctaggcatgctgcgccaacct
atccgtttgattgcttcgcttgatggtagcgaacgcgccgctgaaatgcgtgaactgttg
caagaaattgccgccttgtctgacaaggtcagcctggacgagactggcgatgatgcacgc
aaaccttcattcgtgattgccaaagaaggcgaaacccatggtgtgcgtttcgcggcgatt
ccgctaggccatgagttcacttcattggtactggccttgttgtggaccggcggccatcca
ccaaaagtggagcaggatgtgcttgaccagatcaaggcgctggatagcgatttgaatttt
gaagtctatatgagcttgtcttgccacaactgcccggatgtggtgcaggcaacgacattg
atgactgtgtttaacccacgtatcaatacgacagtgattgacggcgcgctgtttcaggac
gaagtcaatgagcgcaatatcatggcggtaccagcgactttcctcaatggcgagacgttc
gcgtctggccgtatgctggtggaagaaattctggccaaagtggatactggggcagtggca
aaagaggccgaaaaactcaatgccagggagccatttgatgtgctcgtggtgggtggcggt
cctgcaggtgcttctgctgcaatttacgcagcgcgtaaaggcatacgtaccgggattgtg
gcggaacgttttggtggtcaggtcaacgataccctggcgattgaaaactttatttctgtc
aaagaaactgacgggccaaaactggtggctgctttggaagagcacgtcaaaacctatgat
gtggatatcatgcctttgcaacgcgcggtgggtctggccgaacccgctaaagctgacaac
aaacatgccgggttgatcgaggtgaaacttgaaagcggtgcgaccctgcgcagcaagtca
gtgattctggccactggtgcacgttggaaaaaccttaacgtgcctggtgagagcgagtat
aaaaacaaaggtgtggcttactgcccgcactgcgatggtccgttgtttaaaggcaagcat
gtcgcagtgattggtggtggtaactccggtgtggaagccgcaattgacctcgctggtgtg
gttgggcatgtcaccttgctgcagtttgatactgaactgaaagctgatgcggtgttgcaa
cgcaaattgcgctcactggaaaacgtgacgattttgaccagcgcccaaacgaccgaaatt
actggtgacggcacacgtgtgaatggcttgacttatacggaccgtgtctctggtgaaagc
aagcatgtggcactggaaggcgtgtttatccagattggcctggtacccaacagtgactgg
ttgaaaggcaccttagacctgagcaaatatggtgaaattgaaattaaccaccacaatgcc
acctcgttaccgggcgtatttgcggcaggggatgtgacgacgattccctacaaacagatc
atcattgcgatgggggaagggtcaaatgcagcactgggagcttttgattacctgattcgt
caatag

DBGET integrated database retrieval system