KEGG   Methylophilus sp. TWE2: ACJ67_13830Help
Entry
ACJ67_13830       CDS       T04002                                 

Definition
(GenBank) glutamate synthase
  KO
K22083  methylamine---glutamate N-methyltransferase subunit C [EC:2.1.1.21]
Organism
meu  Methylophilus sp. TWE2
Pathway
meu00680  Methane metabolism
meu01100  Metabolic pathways
meu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:meu00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    ACJ67_13830
Enzymes [BR:meu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.21  methylamine---glutamate N-methyltransferase
     ACJ67_13830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glu_synthase FMN_dh IMPDH NMO His_biosynth DHO_dh Glu_syn_central ThiG QRPTase_C G3P_antiterm PcrB
Motif
Other DBs
NCBI-ProteinID: AKR44364
UniProt: A0A0K0SYS3
LinkDB All DBs
Position
complement(2932755..2934092)
Genome map
AA seq 445 aa AA seqDB search
MSDTSKKTPQTEPRFSATFDPGTMSEIRRAAATGIYDIRGAGAKRKLPHFDDLLFLGASV
SRYPLEGYREKCGTDVVLGTRYAKKPIHLKTPVTIAGMSFGALSGPAKEALGRGASAVGT
STTTGDGGMTPEERGQSSILVYQYLPSRYGMNPDDLRKADAIEVVIGQGAKPGGGGMLLG
QKISDRVAKMRCLPKGVDQRSACRHPDWTGPDDLEIKIAELREITDWEKPIYVKVGATRP
YFDVTLAVKAGADVVVLDGMQGGTAATQEVFIEHVGIPILAAIRPAVQALQDMGMHRKVQ
LIVSGGIRNGADVAKALALGADAVAIGTAALIALGDNDPHLEEEYQKLGTTAGAYDDWHE
GKDPAGITTQDPELMKRLDPVKAGRRLANYLSVLTMEAQVIARACGKSHLHNLEPEDLVA
LTIESAAMAKVPLAGTTWIPGTSSF
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacacctctaaaaaaactccgcaaacagaaccgcgtttttctgcgacgtttgat
ccgggaacgatgtcagaaattcgccgtgcagcagccaccggcatttatgatattcgtggc
gcgggagctaaacgaaaattgccacatttcgatgacctattattcttgggagcttctgtc
agtagatacccactggaaggctatcgtgagaaatgtggcacagatgtggtcctcggaaca
cgctatgccaaaaaacctatccatctcaagaccccagtaacgattgcgggcatgagcttt
ggtgcgctgtctgggccagcaaaagaggctctgggccgtggggcaagcgcagtcggtacc
agtacaaccactggggatggcggtatgacgcctgaggagcgtggtcagtcttcgattctg
gtctatcaatacttgccttcccggtatggcatgaatccagatgatctgcggaaagcggat
gccattgaagtggtgattggccaaggcgcgaagcctggtggcggggggatgttgctgggc
cagaaaattagtgaccgtgtcgcgaaaatgcgttgcttgcctaaaggcgtcgatcaacgt
tctgcatgtcgccatccagactggactggtccagatgacttggaaattaagattgctgaa
ctgcgtgagatcacagattgggaaaaaccaatttatgtgaaggtcggtgctacgcgtcca
tattttgatgtcacactcgcggttaaagcgggcgccgatgttgtggtactcgatggtatg
caaggggggaccgctgccacccaggaggtgttcattgaacatgtgggcatcccgattcta
gcggccattcgaccagctgttcaggcactgcaagatatgggtatgcaccgtaaagttcag
ctgattgtttcggggggtatcagaaatggtgctgatgtcgctaaagccttggcgttgggc
gcagatgctgttgctatcggcactgctgcattaattgcgttgggcgataacgatccacat
ctggaagaggaataccaaaaacttgggaccaccgctggcgcttatgatgattggcatgaa
ggtaaggaccccgcagggattacaactcaagatccagagttgatgaagcgattagatccg
gtgaaagctggtcgtcgtcttgcaaactatctctctgtgctgaccatggaagctcaggtg
attgcgagagcctgcggtaaatctcacttgcataatttggagcctgaggatttggtggca
ctcacgattgaatccgcagccatggccaaggtgccgctcgcagggactacctggattcca
ggaacgtcttcgttctga

DBGET integrated database retrieval system