KEGG   Methanohalobium evestigatum: Metev_0789Help
Entry
Metev_0789        CDS       T01261                                 

Definition
(GenBank) DNA ligase D, 3'-phosphoesterase domain protein
Organism
mev  Methanohalobium evestigatum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N
Motif
Other DBs
NCBI-ProteinID: ADI73689
UniProt: D7E8L8
LinkDB All DBs
Position
752974..753432
Genome map
AA seq 152 aa AA seqDB search
MIEEYSKKRDFEKTPEPSPSSRKPDPENPVYVIQKHNASKLHYDLRLEMNGVLKSWAIPK
EPSKNPDVKRLAIQTEDHPLEYADFEGEIPEGQYGAGTVEIWDKGTFEPVKTEDEEIIFR
LKGNKLEGDYVLIKTKYGKDKNSWLFFKKKND
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atgattgaggagtacagcaaaaaaagagattttgaaaaaactccagaaccttcaccaagt
agcagaaaaccggacccagaaaatcctgtatatgtaatccagaaacataatgcaagtaaa
ttacactatgaccttcgccttgaaatgaacggagtattaaaaagctgggcgattccaaaa
gaaccatcgaaaaaccctgacgtaaaacgtcttgctatacagactgaagaccatccgctt
gaatatgcagattttgaaggcgaaattcccgaaggacaatacggtgcaggaacagttgaa
atttgggataaaggaacttttgaacctgttaaaaccgaggatgaagaaattatattcagg
ttaaaaggcaataaactggaaggtgattatgtgctcataaaaacaaaatacggaaaggat
aaaaacagctggttatttttcaaaaagaaaaatgattaa

DBGET integrated database retrieval system