KEGG   Methanohalobium evestigatum: Metev_0890Help
Entry
Metev_0890        CDS       T01261                                 

Definition
(GenBank) DNA ligase I, ATP-dependent Dnl1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
mev  Methanohalobium evestigatum
Pathway
mev03030  DNA replication
mev03410  Base excision repair
mev03420  Nucleotide excision repair
mev03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:mev00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    Metev_0890
   03410 Base excision repair
    Metev_0890
   03420 Nucleotide excision repair
    Metev_0890
   03430 Mismatch repair
    Metev_0890
Enzymes [BR:mev01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     Metev_0890
    6.5.1.6  DNA ligase (ATP or NAD+)
     Metev_0890
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     Metev_0890
DNA replication proteins [BR:mev03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    Metev_0890
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     Metev_0890
DNA repair and recombination proteins [BR:mev03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     Metev_0890
   NER (nucleotide excision repair)
    Other NER factors
     Metev_0890
   MMR (mismatch exicision repair)
    Other MMR factors
     Metev_0890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-ProteinID: ADI73787
UniProt: D7E8W6
LinkDB All DBs
Position
complement(846413..848122)
Genome map
AA seq 569 aa AA seqDB search
MTSFKQFADACKNIEKITSSLEMTDQVADLLAKVDTDELPVVTHFIMGQIFPSWSSQELG
IGESLLYTALSKASGLSVDDIENIIRDTGDIGETAVRALSKLSRNQVTFSSFVEEPTPQI
TILEVSDRLKRIANVSGKGSQNQKVKNLQYLFNASSPEEARYLSRLAVEELRIGVGEGIV
RDAISKAFNVPVEKLERSFMLTNDLGAVAVAAQQGGEEEVSKLDIQVNRPVRMMLAQVTP
SIETAFNEMGTAAIEWKFDGARVQIHKDKEEVNIFSRKLENVTNSLPDIVESVKNQLNAD
TAIIDGEAVAIDEDGRPRAFQDILRRFRRKYDVLSTSKEIPIILNMFDLMYLDGESYIDL
PLKYRREILGNIVENTKSIKVDKQILTSDVEEANRVYNNALSAGHEGIMIKNPESPYSPG
KRGKNWLKKKPIMETLDLVVIGGEWGYGRRANLIGSYAIACYDRDRGQYLPIGKVATGIT
DEKLEELTSLFSDLIVSEKGRKIEFKPEIVFEIGFEEIQKSNNYESGYALRFPRLVNVRD
DKSPEESDTIERIEDIYLKQRSRNHNNSS
NT seq 1710 nt NT seq  +upstreamnt  +downstreamnt
atgacaagtttcaaacaattcgcagatgcctgcaagaatatagaaaaaattaccagttcc
cttgagatgacagaccaggtagcagatttactggctaaagtagatacggatgagttacca
gtggtgacacattttataatgggtcagatatttccttcatggagttctcaggaacttggt
atcggtgaaagtcttctctatacagcactttccaaagcatctggtttatcagttgatgat
attgaaaacataatccgtgatacaggtgatataggagaaaccgcagtaagggcactgtca
aaattgtccaggaaccaggttactttttcgtcttttgttgaagaaccaacgcctcagatt
acaatacttgaagtttcagaccggctcaaacgtatagccaatgtatcaggtaaaggttca
cagaaccagaaagtaaaaaaccttcaatatctgttcaatgcatcttctcctgaagaggca
aggtatctttcaagactcgcagtcgaagagttaaggataggagttggagagggtatagtt
cgtgatgcaatatcgaaggctttcaatgttccagtagaaaagctggaacgcagttttatg
ctgacaaatgatttgggtgcagtggcagtagctgctcagcagggaggtgaagaggaagtt
tcaaaacttgatatacaggtaaaccgtcctgtcaggatgatgcttgcacaggttacgcca
agcattgaaactgcgtttaatgagatgggtactgcagcaatcgagtggaaattcgatgga
gcaagagttcagatacacaaggacaaggaagaggtaaacatattctcaaggaaacttgaa
aacgttaccaattctcttcccgatattgttgaatctgtcaagaaccagttgaatgccgat
actgcaattattgatggtgaagcggtggcaatagacgaagatggacgtccacgtgctttt
caggatattttgaggcgttttagacgaaaatatgacgtattgtctacatccaaagaaatt
cctattattttgaatatgtttgatcttatgtatcttgatggtgaaagttatatcgacctg
ccgcttaaatacagaagagagatacttggaaacattgttgaaaacactaaatcaattaaa
gtggataaacaaatcctaaccagtgatgttgaagaggctaacagggtatacaataatgca
ctatcagcaggtcatgaaggtatcatgattaaaaaccctgaatcaccgtattcacccggt
aaacgtgggaaaaactggctaaagaaaaaacccataatggagacacttgaccttgttgtt
atagggggagaatggggttatggaagaagagccaatctcatcggttcatatgctatcgct
tgctatgacagggataggggtcaatatttgcctatagggaaagtggcaacaggtatcacc
gatgaaaaactggaagaacttaccagtcttttctcagatttgatagttagtgaaaaaggg
cgaaaaatagaattcaaacctgaaatcgtttttgaaattggatttgaagaaatccagaaa
agcaacaattacgaatcaggttatgcgctccgatttccaagacttgtaaatgtcagggat
gataaatcacctgaagagtcagacacaatagaacgtatagaagatatttacctgaaacaa
agaagcaggaatcataataattcttcttga

DBGET integrated database retrieval system