KEGG   Methanohalobium evestigatum: Metev_2017Help
Entry
Metev_2017        CDS       T01261                                 

Definition
(GenBank) tetrahydromethanopterin S-methyltransferase, subunit D
  KO
K00580  tetrahydromethanopterin S-methyltransferase subunit D [EC:2.1.1.86]
Organism
mev  Methanohalobium evestigatum
Pathway
mev00680  Methane metabolism
mev01100  Metabolic pathways
mev01120  Microbial metabolism in diverse environments
mev01200  Carbon metabolism
Module
mev_M00357  Methanogenesis, acetate => methane
mev_M00567  Methanogenesis, CO2 => methane
mev_M00617  Methanogen
Brite
KEGG Orthology (KO) [BR:mev00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    Metev_2017
Enzymes [BR:mev01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.86  tetrahydromethanopterin S-methyltransferase
     Metev_2017
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MtrD
Motif
Other DBs
NCBI-ProteinID: ADI74846
UniProt: D7EBK4
LinkDB All DBs
Position
2022363..2023082
Genome map
AA seq 239 aa AA seqDB search
MIDIVGILSANLLYVLLITIGGTLVSFSVHFVPVGGAPAAMAQAPGIGTGTVQLAAGAGL
TGLITAGTVLGLTNSIAIVLASGAVGAMLMIGSTMIIGQMVYVFGVGVPPAGGKSKYDPI
TKDKQDIYSSQGTEGHGLPTASYISGIIGGGLGGLGGSLVYYSLVNVTNNIGMTDLAGLA
GIFAVGIFFINAVIPSYNIGGTTEGFHDPKFKRWYRAVISSIIATFMCAIIGVLAIGGL
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgatagatatcgttggaattctttcagccaacctattatatgtgcttcttattactatc
gggggcacacttgtttcgtttagtgttcattttgttcctgtcggtggtgcacctgcagca
atggcacaggcaccaggtattggaactggtactgtgcaattggctgccggtgcgggttta
actggattaattaccgccggtacagttttgggactgacaaacagtattgcaatcgtcctt
gcatctggtgcagtcggtgcaatgttaatgattggaagtaccatgatcattggacagatg
gtatacgtttttggagttggtgtacccccagccggtggtaaatccaaatatgaccctatt
acaaaagacaagcaagacatctattcctctcaaggtactgaaggacacggtcttccgact
gcatcctatatcagtggaataatcggcggtggtcttggtggtcttggtggatcactggtt
tactattcactggttaacgtcaccaataatataggtatgacagaccttgccggtttagca
ggtatttttgctgttggtattttcttcataaatgcagttataccatcatacaacatcgga
gggaccacagaaggtttccacgaccccaaattcaaaagatggtacagagcagtaatttca
tccataattgcaacatttatgtgtgcaattataggcgtactcgctataggaggtctgtaa

DBGET integrated database retrieval system