KEGG   Methanobacterium paludis: MSWAN_0017Help
Entry
MSWAN_0017        CDS       T01509                                 

Definition
(GenBank) Bifunctional enzyme fae/hps
  KO
K13812  bifunctional enzyme Fae/Hps [EC:4.2.1.147 4.1.2.43]
Organism
mew  Methanobacterium paludis
Pathway
mew00030  Pentose phosphate pathway
mew00680  Methane metabolism
mew01100  Metabolic pathways
mew01120  Microbial metabolism in diverse environments
mew01200  Carbon metabolism
mew01230  Biosynthesis of amino acids
Module
mew_M00580  Pentose phosphate pathway, archaea, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:mew00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    MSWAN_0017
  09102 Energy metabolism
   00680 Methane metabolism
    MSWAN_0017
Enzymes [BR:mew01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.43  3-hexulose-6-phosphate synthase
     MSWAN_0017
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.147  5,6,7,8-tetrahydromethanopterin hydro-lyase
     MSWAN_0017
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fae OMPdecase Ribul_P_3_epim PRAI QRPTase_C
Motif
Other DBs
NCBI-ProteinID: AEG17065
UniProt: F6D7C3
LinkDB All DBs
Position
complement(17597..18817)
Genome map
AA seq 406 aa AA seqDB search
MYQIGEALIGNGDEVAHVDLVIGDKKGPVGDAFVNNMTNLSIGHTPLLSVIRPNLMTKPA
TLIIPKVTVRDLEDADKIFGPAQTAVGRAVADAVAEGIIPQEEAEDIVIMVSVFISPSAK
DFRKIYQYNYGATKLAIKRAMEGYPSVKKVLAEKDRGTHPIMGFKVTKLWNSPYLQVALD
LDNLTEMERIIKTLPDRERVLIEAGTPLVKKFGVGVVGKIRELRRDAFIIADLKTLDVGR
VEVKMAADETADAIAISGLGTVESIEKAIHESSKQGIYSILDMMNVENFVEKLRGLKLKP
DIVLLHRNVDMETSKAERGEKQGERTEWGNINEIKSILGEGKLVAVAGGITPDKVNTALD
SGADIIVVGRYIIGSRDVRRSAQDFLDHMPQDPDTMRLALDEDESV
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgtatcagataggtgaagccttaataggaaatggcgatgaagtagctcacgttgattta
gtaatcggagataaaaaaggtcctgtaggagatgcattcgtaaataacatgacgaatctt
tcaataggtcacactccacttttatcagttataagacccaacctcatgaccaaacctgca
actttgatcattccgaaggtcacagtaagggatcttgaggatgcagataaaatattcggc
ccagcacaaacagctgtgggtcgagctgtggcagatgctgtggcagagggaattataccc
caagaagaagcagaagacattgtaataatggtaagtgtgttcataagccctagtgctaag
gacttccgtaagatctaccagtacaactacggagcgaccaaattggcaataaaaagagca
atggaaggttatccatcagttaaaaaagttttagcagaaaaagacagaggtacccatcca
ataatgggattcaaagtaaccaaattatggaactccccatacctacaggttgcactcgac
ctcgacaacctcactgaaatggagagaataataaaaacactcccggacagggaacgtgtt
ttaatagaagcaggaacaccactcgttaaaaaattcggtgttggagttgttggcaaaata
agggaacttagaagggacgcattcataatagcagacctcaaaacccttgatgttggtcgt
gttgaagttaaaatggcagcagatgaaacagcagatgccattgcaatatccggacttgga
actgtggaatccattgaaaaggccatacatgaatcgtccaaacagggaatttattccata
ctcgatatgatgaacgttgaaaacttcgttgaaaaactcaggggacttaaactcaaacca
gatatcgttctgttacacaggaacgtcgatatggaaacctccaaagctgaaaggggagaa
aaacagggtgaaagaaccgaatggggtaacatcaacgagatcaaaagtatcttgggtgaa
ggaaaacttgttgcagttgcaggcggtataacaccggataaagtcaacactgccctcgat
agcggtgcagacatcattgttgtgggaaggtatatcataggttcaagagatgtaaggcgc
tccgctcaggacttcctggaccacatgccacaagaccctgacacaatgaggctcgccctt
gatgaggatgaatccgtctaa

DBGET integrated database retrieval system