KEGG   Methanobacterium paludis: MSWAN_0168Help
Entry
MSWAN_0168        CDS       T01509                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
mew  Methanobacterium paludis
Pathway
mew00250  Alanine, aspartate and glutamate metabolism
mew00410  beta-Alanine metabolism
mew00430  Taurine and hypotaurine metabolism
mew00650  Butanoate metabolism
mew01100  Metabolic pathways
mew01110  Biosynthesis of secondary metabolites
mew01120  Microbial metabolism in diverse environments
mew02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:mew00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    MSWAN_0168
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    MSWAN_0168
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MSWAN_0168
   00430 Taurine and hypotaurine metabolism
    MSWAN_0168
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    MSWAN_0168
Enzymes [BR:mew01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     MSWAN_0168
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-ProteinID: AEG17214
UniProt: F6D1I6
LinkDB All DBs
Position
complement(191653..193020)
Genome map
AA seq 455 aa AA seqDB search
MKRSEKELTTTYGSRYFAESVPKYVMPEDGMPARAAYQLIHDELNLDGNPALNLASFVTT
WMEPEADKLIMESIDKNFVDNDEYPQTEKIHERVINMLARLFNAPKECHSVGTGTIGSSE
AIMLGLLAHKWTWKKRRQAEGKPFGKPNIVMGADVHTVWEKFALYFDVELKLIPLERDTY
TVTVDQVAEEIDENTICVGAVLGTTFTGQMDPINEINQLLIDIKKEKGWDIPIHVDGASG
GFVAPFLYPDLEWDFKLQQVKSINVSGHKYGLVYPGVGWLIFRDKKDLPEELIFKVNYLG
GLMPNYSLNFSKGSSTIIAQYYNFIRLGKSGYREIMENMIDNSKYLARKLEESGKFDVIN
KDIMFPLVTMSLKNSDFTVFHLSEKLRQKGWIIPAYTLPKNAEDVAVMRMVIKENFGREM
VDMLLDDLIEAYHTLEEEDTEKEGFETGENPSLLY
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgaagagatctgaaaaggaattaaccaccacctacggaagcagatattttgctgaaagt
gtcccaaaatatgtgatgcccgaagatggtatgcctgcacgtgcagcataccaattgata
catgatgaactgaatttggatggcaatcctgctttgaatctggccagttttgtaaccaca
tggatggaacctgaagcagacaaattgataatggaaagcatcgataaaaactttgttgac
aacgatgaataccctcaaaccgaaaaaatacatgaaagagtgattaacatgcttgcaagg
ctgtttaatgctccaaaggaatgtcattcagttggaacaggcaccataggttcatcagaa
gccattatgctgggacttctggcccataaatggacctggaaaaaacgcagacaagcggaa
ggaaagccatttggcaaacccaacattgtgatgggtgcggatgtgcacactgtctgggag
aagtttgccctttacttcgatgtggaattgaaattaataccactagaaagggatacttac
actgtaaccgtggatcaggttgcagaagaaattgatgaaaacaccatctgcgttggtgct
gttttagggacaacatttacaggacagatggatcccataaacgagattaaccagctttta
attgatatcaaaaaagaaaagggctgggacataccaatacatgttgatggagccagcggg
ggatttgtagcccccttcctgtatccagatcttgaatgggatttcaaactccaacaggta
aaatccatcaatgtatccggccacaaatacgggcttgtttacccaggagttggttggttg
attttcagagacaaaaaagaccttcctgaagagttaatctttaaagtaaactaccttggt
ggtttaatgccaaattattcccttaacttctcaaagggaagtagcaccataattgctcaa
tattacaacttcataagacttggaaaaagtggttacagggaaattatggaaaatatgatt
gataacagcaagtatcttgccagaaaacttgaagaatcgggtaaatttgatgtgatcaac
aaagatatcatgtttccattggtcaccatgagcttaaagaattcagacttcacagtcttc
catctttcagaaaaactgcggcagaaaggttggataatacctgcatacactcttccaaag
aatgcagaggacgtagctgttatgaggatggttatcaaagaaaacttcggcagagaaatg
gtagacatgcttttagacgatttaatagaggcttatcacacgttagaggaagaagatacc
gaaaaggaaggttttgaaactggtgaaaatccttctttgctgtattaa

DBGET integrated database retrieval system