KEGG   Methylorubrum extorquens PA1: Mext_1132Help
Entry
Mext_1132         CDS       T00640                                 

Definition
(GenBank) protein kinase
Organism
mex  Methylorubrum extorquens PA1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PP2C_2 PP2C Kinase-like SpoIIE APH Kdo RIO1 Choline_kinase Haspin_kinase Seadorna_VP7
Motif
Other DBs
NCBI-ProteinID: ABY29536
UniProt: A9W1T0
LinkDB All DBs
Position
1235736..1237451
Genome map
AA seq 571 aa AA seqDB search
MPNDLRLTLGQHSAAGRKPHNQDFHGALIPGQPALGLKGAAIVIADGIGSSAVSHVASET
AVKSFLTDYYDTPDTWSVKSAAQRVIAAANSWLHAETRRSRHEPDRGYVTTFSALILKGR
TAHLFHVGDGRICRVAGRSLEQLTEDHRLVLSAEESYLGRALGAGGRVEIDHASVRTEPG
DVFVLTTDGVHEHVDPETIAGLIARHAADLDTAAREIIRHAYEAGSSDNLTAQIVRIEAA
PEDGPADLAGRVADLAPAPLLDPPTDFDGYRVLRTLHASHRSHVYLALDSETGATVALKV
PSTEARDDPAQLRRLVMEEWIARRIDSPHVLKAQPQARRRSHLYTAMEYVEGRTLAQWMR
DNPAPDLETVRSLVEQIARGLQAFHRREMVHQDLRPQNVLIDAAGTVRIIDFGATRVAGV
AELAPEEPVLGTQQYSAPEYLAGHPGTSAADVFSLGIIAYQMLTGQLPYGAAAARALTEA
RARRLRYVPLSAVRPGLPIWVDGALRKAVHPNPALRYEALSAFTYDLRHPNPSLAGMRRA
ALLERNPVLFWKLVSLGLGLALLALLVSRAV
NT seq 1716 nt NT seq  +upstreamnt  +downstreamnt
atgccgaacgacctcaggctcacgctcggccagcacagcgcggcgggtcgcaagccccac
aaccaggattttcacggggcgctcatccccgggcagccggctctggggctcaagggcgcg
gccattgtgatcgcggacgggatcggcagcagtgcggtcagccacgtggccagcgagacc
gcggtcaagagcttccttaccgactactatgacacccccgacacatggtcggtgaagagc
gcggcgcagcgcgtgatcgcggcggccaattcctggctccacgccgagacgcggcgcagc
cggcacgagcccgaccgcggctacgtcaccaccttcagcgccctcatcctcaagggccgc
accgctcacctcttccacgtcggcgacgggcggatctgccgggttgcgggccgctccttg
gagcagctgaccgaggatcaccgcctcgtcctgtcggcggaggaatcctatctcggccgg
gcactcggcgcgggcggacgcgtggagatcgaccatgccagcgtgcggaccgagcccggc
gacgtcttcgtcctgaccaccgacggcgtgcacgagcacgtcgatccggagacgatcgct
ggcctgatcgcgcgccatgctgccgatctggacacggctgcccgcgaaatcatcagacat
gcctacgaagccggcagcagcgacaatctcaccgcacagatcgtgcgcattgaggcagca
cccgaggacggaccagccgatctagcgggccgcgtcgcggatctggcacccgcgcccctg
ctcgatccaccgaccgatttcgacggctaccgggtgctgcgcacgctccacgcgagccac
cgcagccacgtctatctcgcgctggattccgagaccggcgcgaccgtcgccctcaaggtg
ccctcgacggaagcacgcgacgaccccgcgcagctgcgccggctggtgatggaggagtgg
atcgcccggcgcatcgacagcccgcacgtgttgaaggcccagccgcaggcgcggcggcgc
agccacctctacacggcgatggagtatgttgagggacgcacgctggcgcagtggatgcgg
gacaatcccgcaccggacctcgagaccgtgcgcagccttgtcgagcagatcgcgcggggc
ctgcaggcctttcaccggcgcgagatggtgcaccaggacctgcggccccagaacgtcctg
atcgacgccgccggcaccgtacggatcatcgatttcggcgcgacgcgcgtggcgggcgtg
gccgagctcgcccccgaggaaccggtgctcggcacccagcagtacagcgcgcccgaatac
ctcgccggccatcccggtacatccgcggcggacgtgttctccctcgggatcatcgcctac
cagatgctgactggacagttgccctatggcgcggcggccgcccgggccttaaccgaggcg
cgggcgcggcgcctgcgctacgtcccgctctcggccgtgcggccgggcctgccgatctgg
gtcgacggcgccctgcgcaaggccgtccacccgaacccggcgctgcgctacgaggcgctg
tcggccttcacctacgacctgcgccacccgaacccttcgctcgccggaatgcgccgggcg
gctttgctggagcgcaatccggtcctgttctggaaactggtctcgctagggctcgggctc
gcgctcctcgccctgctagtgagccgagcggtctga

DBGET integrated database retrieval system