KEGG   Methylorubrum extorquens PA1: Mext_3064Help
Entry
Mext_3064         CDS       T00640                                 

Definition
(GenBank) glutamyl-tRNA(Gln) amidotransferase, B subunit
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
mex  Methylorubrum extorquens PA1
Pathway
mex00970  Aminoacyl-tRNA biosynthesis
mex01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mex00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Mext_3064
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:mex03029]
    Mext_3064
Enzymes [BR:mex01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     Mext_3064
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     Mext_3064
Mitochondrial biogenesis [BR:mex03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Mext_3064
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-ProteinID: ABY31453
UniProt: A9VWZ8
LinkDB All DBs
Position
complement(3410079..3411551)
Genome map
AA seq 490 aa AA seqDB search
MTERVDPKKLIKGGLHDWEVVIGMEIHAQVTSRSKLFSGASTEFGGEPNDHVSLVDAAMP
GMLPVINEECVAQAVRTGLGLKAQINLRSVFDRKNYFYPDLPQGYQISQYKDPIVGEGEV
LVDLPEGESMTVGIERLHLEQDAGKSLHDQDPTKSFVDLNRSGVALMEIVSRPDLRSSEE
ARAYVTKLRTILRYLGTCDGDMEKGSLRADVNVSVRRPGEPLGTRCEIKNVNSIRFIGQA
IETEARRQIAILEDGGKIDQETRLYDPGKGETRSMRSKEEAHDYRYFPDPDLLPLEFDQA
YVDALASGLPELPDAKKARFIKDFGLSAYDAGVLVAERASADYFEAVARGRDGKAAANWV
INELFGRLNKEGRSIEDTPVSAEQLGTIVDLIGDGVISGKIAKDLFEIVWSEGGDPRAIV
EARGMKQVTDTGAIEAAVDAIIAANPDKVEQAKAKPTLLGWFVGQTMKATGGKANPAAVN
ALLKDKLGIE
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagcgcgtcgatccgaagaagctcatcaagggcggcctgcacgactgggaggtc
gtgatcggcatggagatccacgcccaggtcacgagccgctccaagctgttctccggcgcc
tcgaccgaattcggcggcgagcccaacgaccacgtttcgctggtcgacgcggccatgccc
ggcatgctgccggtcatcaacgaggaatgcgtcgcccaggccgtacgcaccggtctcggg
ctgaaggcccagatcaaccttcgctcggtcttcgaccggaagaactacttctatccggac
ctgccgcagggctaccagatctcgcagtacaaggacccgatcgtcggcgagggcgaggtg
ctggtcgatctgcccgagggcgagtcgatgacggtgggcatcgagcgcctgcacctcgaa
caggatgccggcaagtcgctgcacgatcaggatccgaccaagagcttcgtcgatctcaac
cgctccggcgtggcgctgatggagatcgtctcccggcccgatctgcgctcctccgaggag
gcccgagcctacgtgacgaagctgcgcacgatcctgcgctacctcggcacttgcgacggc
gacatggagaaggggagccttcgcgccgacgtgaacgtctccgtgcgccgccccggcgag
ccgctcggcacgcgctgcgagatcaagaacgtcaattcgatccgcttcatcggtcaggct
atcgagaccgaggcgcgccgccagatcgcgatcctggaggatggcggcaagatcgatcag
gagacgcgcctctacgacccgggcaagggcgagacccgctcgatgcgctcgaaggaagag
gcgcacgactatcgctacttccccgatcccgacctgttgccgctcgaattcgatcaggcc
tacgtcgatgcgttggcctcgggcctgccggaactgccggacgccaagaaggcgcgcttc
atcaaggatttcggcctcagcgcctacgatgccggcgtgctcgtcgccgagcgggcctcg
gccgactacttcgaggcggtggcccgcgggcgcgacggcaaggccgccgcgaactgggtc
atcaacgagctgttcggccgcctcaacaaggaggggcgcagcatcgaggacacgccggtt
tccgctgagcagctcggcaccatcgtcgatctgatcggcgacggcgtgatctcaggcaag
atcgccaaggacctgttcgagatcgtctggtccgagggcggcgacccgcgcgcgatcgtc
gaggcccgcggcatgaagcaggtcaccgataccggcgccatcgaggcggcggtggacgcg
atcatcgccgccaaccccgacaaggtcgagcaggccaaggccaagccgaccctgctcggc
tggttcgtcggccagaccatgaaggcgacgggcggcaaggccaatccggccgcggtcaac
gcgctgctgaaggataaactcggtatcgagtag

DBGET integrated database retrieval system