KEGG   Methylorubrum extorquens PA1: Mext_3423Help
Entry
Mext_3423         CDS       T00640                                 

Definition
(GenBank) Aldehyde Dehydrogenase
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
mex  Methylorubrum extorquens PA1
Pathway
mex00010  Glycolysis / Gluconeogenesis
mex00620  Pyruvate metabolism
mex01100  Metabolic pathways
mex01110  Biosynthesis of secondary metabolites
mex01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mex00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mext_3423
   00620 Pyruvate metabolism
    Mext_3423
Enzymes [BR:mex01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     Mext_3423
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh OmdA
Motif
Other DBs
NCBI-ProteinID: ABY31809
UniProt: A9W7P0
LinkDB All DBs
Position
3797926..3799449
Genome map
AA seq 507 aa AA seqDB search
MNKPEFLADAKTKSPFSARYDNFIGGQWVAPASGRYFENTSPITGKVICEVARSEAADIE
RALDAAHAAKDAWGRTAPAERARILNKIADRMEDNLDLIALAETWDNGKPIRETTAADIP
LAIDHWRYFASCVRAQEGAISEIDHDTVAYHFHEPLGVVGQIIPWNFPILMAVWKLAPAI
AAGNCVVLKPAEQTPASILVVMELIGDLLPPGVINVVNGFGLEAGKPLASNPRIAKIAFT
GETTTGRLIMQYASQNLIPVTLELGGKSPNIFFGDVVNEDDDFFDKALEGFTMFALNQGE
VCTCPSRALVHESIYDRFIERAIKRVEAITQGSPLDPATMIGAQASSEQLEKILSYVDIG
RQEGAECLTGGARGTREGDLADGFYMQPTVFKGHNKMRIFQEEIFGPVLSVTTFKDDEEA
LSIANDTLYGLGAGVWTRDGTRAYRFGRAIQAGRVWTNCYHAYPAHAAFGGYKQSGIGRE
THKMMLDHYQQTKNMLVSYSSKKLGFF
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgaacaagcccgaattcctggcggatgccaagacgaagtcgccgttttcggcgcgctac
gacaacttcatcggcggccagtgggtcgcgccggcgagcggccgctacttcgagaacacc
tcccccatcaccggcaaggtgatctgcgaggtcgcccgctcagaggcggcggacatcgag
cgggcgctcgacgccgcgcacgccgccaaggatgcctggggccgcaccgcaccggccgag
cgcgcccgcatcctcaacaagatcgccgaccggatggaggacaacctcgatctgatcgcg
ctggccgagacctgggacaacggcaagccgatccgcgagaccaccgccgccgacatcccg
ctcgccatcgaccactggcgctacttcgccagctgcgtccgcgcccaggaaggcgcgatc
tccgagatcgaccacgacacggtggcctatcacttccacgagccgctcggcgtcgtcggc
cagatcatcccgtggaacttcccgatcctgatggcggtgtggaagctggcgcctgcgatc
gccgccggcaactgcgtggtgctcaagcccgccgagcagacccccgcctcgatcctcgtg
gtgatggagctgatcggcgacctgctgccgccgggcgtcatcaacgtcgtcaacggcttc
ggcctggaggccggcaagccgctcgcctcgaacccgcgcatcgccaagatcgccttcacc
ggtgagacgaccaccggccgcctcatcatgcagtacgcctcgcagaacctgatcccggtg
acgctggagctgggcggcaagtcgccgaacatcttcttcggggatgtcgtcaacgaggat
gacgacttcttcgacaaggcgctcgaaggcttcaccatgttcgccctcaaccagggcgaa
gtctgcacctgcccgagccgcgcgctcgtgcacgagtcgatctacgaccgcttcatcgag
cgcgcgatcaagcgcgtcgaggcgatcacccagggctcgccgctcgatccggcgacgatg
atcggcgcgcaggcctcctcggagcagctcgagaagattctcagctacgtcgatatcggc
cgccaggaaggcgccgagtgcctcacgggcggcgcccgcggcacccgcgagggcgatctg
gccgacggcttctacatgcagccgacggtgttcaagggccacaacaagatgcggatcttc
caggaggagatcttcgggcccgtcctctcggtcacgaccttcaaggacgacgaggaggcg
ctctccatcgccaacgacacgctctacggcctcggcgccggcgtgtggacccgcgacgga
acccgcgcctaccgcttcggccgcgccatccaggccggccgcgtctggacgaactgctac
cacgcctatccggcgcacgcggccttcggcggctacaagcagtccggcatcggccgtgag
acccacaagatgatgctcgaccactaccagcagaccaagaacatgctggtcagctactcc
tcgaagaagctcgggttcttctaa

DBGET integrated database retrieval system