KEGG   Methylorubrum extorquens PA1: Mext_4025Help
Entry
Mext_4025         CDS       T00640                                 

Definition
(GenBank) Glutathione S-transferase domain
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
mex  Methylorubrum extorquens PA1
Pathway
mex00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:mex00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Mext_4025
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mex02000]
    Mext_4025
Enzymes [BR:mex01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     Mext_4025
Transporters [BR:mex02000]
 Other Transporters
  Pores ion channels [TC:1]
   Mext_4025
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C_2 GST_C Tom37
Motif
Other DBs
NCBI-ProteinID: ABY32395
UniProt: A9W8P6
LinkDB All DBs
Position
complement(4473267..4473908)
Genome map
AA seq 213 aa AA seqDB search
MSDDLVFYTNPMSRGRIVRWMLEEVGAPYHTEILGYGSSMKAPAYRAINPMGKVPALRHG
ETVVTECPAILAYLADAFPQAGLAPEPSHHDRGPYYRWLFFCAGPLEAAVTNGVLKVSVP
DDPRMQGMVGYGSLETALDTLEGAVSGVEFVAGDRFSAADLYVAAHLGWGMQFGTIPKRP
AFEAYAGRHLAREAAARARAIDDALLAEAQAAS
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgtccgacgatctcgtcttctacaccaacccgatgtcccgcggccggatcgtccgctgg
atgctggaagaggtcggcgcgccctaccacaccgagatcctcggctacggcagctccatg
aaggcgccggcctaccgggcgatcaacccgatggggaaggtgccggctctgcgccacggc
gagacggtggtgaccgagtgccccgcaatcctcgcctatctcgccgacgccttcccgcag
gccgggctcgcccctgagcctagccaccacgaccgcggcccctattatcgctggctgttc
ttctgcgccgggccgctcgaggcggcagtgacgaacggcgtactcaaggtgagcgtcccc
gacgatccgcgcatgcagggtatggtcggctacggcagcctggagacagccctcgacacg
ctcgaaggcgccgtttccggggtggagttcgtagcgggcgaccggttcagcgccgccgac
ctctacgtcgccgcgcatctcggctggggcatgcagttcggcacaatcccgaagcgcccg
gccttcgaggcctatgccgggcgccacctcgcccgcgaggcggccgcgcgggcgcgggcg
atcgatgacgctttgctcgccgaggcgcaggcggcgtcatag

DBGET integrated database retrieval system