KEGG   Methylorubrum extorquens PA1: Mext_4495Help
Entry
Mext_4495         CDS       T00640                                 

Definition
(GenBank) nitrate ABC transporter, inner membrane subunit
  KO
K15577  nitrate/nitrite transport system permease protein
Organism
mex  Methylorubrum extorquens PA1
Pathway
mex00910  Nitrogen metabolism
mex02010  ABC transporters
Module
mex_M00438  Nitrate/nitrite transport system
mex_M00615  Nitrate assimilation
Brite
KEGG Orthology (KO) [BR:mex00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    Mext_4495
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Mext_4495
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mex02000]
    Mext_4495
Transporters [BR:mex02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Nitrate/nitrite transporter [MD:M00438] [OT]
    Mext_4495
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: ABY32863
UniProt: A9W9N6
LinkDB All DBs
Position
complement(5013639..5014496)
Genome map
AA seq 285 aa AA seqDB search
MATGATLTATRERAAKARTPFITLAGLRGVAARVLPPLVVLAGFLLLWEVLCSSPTAGLP
PPSRVVTEAWDIIIDPFYDNGGTDKGLFWHIAASLKRVALGFSLAVVAGVMLGTLVGQSD
WAMRGLDPIFQILRTIPPLAWLPLSLAAFRDGQPSAIFVIFITSIWPIIINTAVGIRNIP
QDYRNVAAVIRLNPIEFFVKIMLPSAAPYIFTGLRIGVGLSWLAIVAAEMLIGGVGIGFF
IWDAWNSSHISEIIVALVYVGLIGFVLDRMVAGLGVLVTRGTSAA
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atggctaccggagcaacgctcaccgcaacccgcgaacgcgccgccaaggcccgcacgccc
ttcatcaccctggccggcctgcgcggcgtcgccgcccgcgtcctgccgccgctcgtcgtc
ctggcgggcttcctgctcctgtgggaggtgctgtgctcctcccccaccgccggcctgccg
ccgccctcgcgggtggtgacggaagcctgggacatcatcatcgatccgttctacgacaac
ggcggcaccgacaagggcctgttctggcatatcgccgcgagcctgaagcgcgtggcgctg
ggcttctcgctggcggtggtggcgggcgtgatgctcggcacgctggtcggccagtccgac
tgggcgatgcgcgggctcgacccgatcttccagatcctgcgtacgatcccgccgctggcg
tggctcccgctctcgctggccgccttccgcgacggtcaaccgagcgcgatcttcgtgatc
ttcatcacctcgatctggccgatcatcatcaacaccgcggtcggcatccgcaacattccg
caagactaccggaacgtcgccgcggtcatccggctgaacccgatcgagttcttcgtgaag
atcatgctgccctcggcggccccctacatcttcaccggtcttcgcatcggcgtcggcctg
tcctggctcgccatcgtcgcggccgagatgctgatcggcggcgtcgggatcggcttcttc
atctgggacgcgtggaactcgtcgcacatctccgagatcatcgtcgccctcgtctatgtc
gggctcatcggcttcgtcctcgaccggatggtcgccgggctcggcgtgctcgtgacccgc
ggcaccagcgcagcgtga

DBGET integrated database retrieval system