KEGG   Methylobacterium extorquens PA1: Mext_4778Help
Entry
Mext_4778         CDS       T00640                                 

Definition
(GenBank) uncharacterized relative of glutathione S-transferase MAPEG superfamily-like protein
  KO
K07136  uncharacterized protein
Organism
mex  Methylobacterium extorquens PA1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MAPEG
Motif
Other DBs
NCBI-ProteinID: ABY33146
UniProt: A9W9A7
LinkDB All DBs
Position
complement(5339108..5339506)
Genome map
AA seq 132 aa AA seqDB search
MIFPTTTAFYAAILGLIYAGLTGWVIGGRVTGNVLFGDGGQDALQRRIRSHGNFQEYVPL
TLLLIALYEAGGGSQGWVQGLLIVLVIARILHPIGMFAPTNSPRQFACRGGGILATFAVM
TIASILLLLRVG
NT seq 399 nt NT seq  +upstreamnt  +downstreamnt
gtgatttttccgaccaccacggccttctacgccgcgattctgggcctgatctatgccgga
ctgaccggatgggtgatcggcggccgggtcaccggcaacgtcctgttcggcgatggcggg
caggacgcgctccagcggcgcatccgctcacacggcaacttccaggaatatgtgccgctg
accctgctgctgatcgcgctctacgaggcgggcggcggctcccagggctgggttcagggc
ctgctgatcgtgctggtgatcgcgcgcatcctgcatccgatcgggatgttcgcccccacg
aactcgccgcgccagttcgcctgccggggcggcggcattctcgcgacgttcgcggtcatg
acgatcgcgtcgatcctgctgctgctgcgggtcggctga

DBGET integrated database retrieval system